(data stored in ACNUC13479 zone)

EMBL: CP002688.PE111

CP002688.PE111       Location/Qualifiers
FT   CDS_pept        join(231075..231161,231485..231539,231624..231994)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.130"
FT                   /gene_synonym="F7A7_130"
FT                   /locus_tag="AT5G01610"
FT                   /product="hypothetical protein (Protein of unknown
FT                   function, DUF538)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01610"
FT                   /db_xref="GOA:Q9M015"
FT                   /db_xref="InterPro:IPR007493"
FT                   /db_xref="InterPro:IPR036758"
FT                   /db_xref="PDB:1YDU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M015"
FT                   /protein_id="ANM68392.1"
FT                   /translation="MDQIFNKVGSYWLGQKANKQFDSVGNDLNSVSTSIEGGTKWLVNK
FT                   IKGKMQKPLPELLKEYDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKF
FT                   TTTVTGHLEKGKLTDVEGIKTKVMIWVKVTSISTDASKVYFTAGMKKSRSRDAYEVQRN
FT                   GLRVDKF"
     atggatcaga tcttcaacaa ggttggatcc tactggttag gccaaaaggc taacaagcag        60
     tttgactccg tcggcaacga tctcaactcg gtgtcaacga gcattgaagg aggaacaaaa       120
     tggttggtca acaaaatcaa agggaaaatg cagaagccgt tgcctgagtt actaaaagaa       180
     tatgatttgc cgattggaat cttcccggga gatgctacaa actacgagtt cgatgaagag       240
     acaaagaaac taaccgtttt gatcccatcg atatgcgaag ttggatacaa ggattcatca       300
     gtgttgaagt tcacaacaac agtaacagga catcttgaga aaggaaagct aacagatgtg       360
     gaaggaatca agacaaaagt aatgatatgg gtaaaagtga caagcatatc tacagatgca       420
     tcaaaggtct atttcactgc aggaatgaag aagagcagaa gcagagatgc ttatgaggtt       480
     caaagaaatg gtctccgagt cgataaattc taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page