(data stored in ACNUC13479 zone)

EMBL: CP002688.PE115

CP002688.PE115       Location/Qualifiers
FT   CDS_pept        join(232882..233092,233207..233492,233691..233862,
FT                   233964..234160,234242..234394,234491..234821)
FT                   /codon_start=1
FT                   /gene="TBL35"
FT                   /gene_synonym="F7A7.140"
FT                   /gene_synonym="F7A7_140"
FT                   /gene_synonym="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /locus_tag="AT5G01620"
FT                   /product="TRICHOME BIREFRINGENCE-LIKE 35"
FT                   /note="TRICHOME BIREFRINGENCE-LIKE 35; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 14 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein of unknown function DUF231, plant
FT                   (InterPro:IPR004253); BEST Arabidopsis thaliana protein
FT                   match is: TRICHOME BIREFRINGENCE-LIKE 34
FT                   (TAIR:AT2G38320.1); Has 1369 Blast hits to 1347 proteins in
FT                   38 species: Archae - 0; Bacteria - 0; Metazoa - 25; Fungi -
FT                   0; Plants - 1344; Viruses - 0; Other Eukaryotes - 0
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q8RXQ1"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXQ1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV785707.1,INSD:CF772985.1,INSD:AV441710.1,
FT                   INSD:ES123425.1,INSD:DR379270.1,INSD:ES003552.1,
FT                   INSD:EH852298.1,INSD:DR378727.1,INSD:ES181936.1,
FT                   INSD:EL146039.1,INSD:AU227536.1,INSD:AV543066.1,
FT                   INSD:ES066611.1,INSD:EL131616.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY117243.1,INSD:BX831772.1,INSD:AY080736.1"
FT                   /protein_id="AED90367.1"
FT                   /translation="MSQRWSRKKSRLPLAGLLFILVVTFMILFNERSIQQIHHHAASHT
FT                   QNLREPSTFDFVKPNVPRINYLGAHEVLDRFSKCNSTKEYSGKKIGWVDPFEDHPGQVT
FT                   KEEQKCDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPHACN
FT                   LKRWNAIEMWEKLRGKRLMFVGDSLNRGQWISMVCLLQSVIPRDKQSMSPNAHLTIFRA
FT                   EDYNATVEFLWAPLLVESNSDDPVNHRLSERIIRPDSVLKHASKWQHADILIFNTYLWW
FT                   RQDSVKLRWSSEEKGSCEEVKSAEGMEMAMDSWGDWVANNVDPNKKRVFFVTMSPTHQW
FT                   SREWNPGSEGNCYGEKKPIEEESYWGSGSDIPTMRMVKRVLERLGPKVSVINITQLSEY
FT                   RKDGHPSVYRKFWEPLNEDRLKNPASYSDCTHWCVPGVPDVWNQLLFHFL"
     atgtcgcaga gatggagtag aaagaagagt agacttccat tagcgggtct cctctttatt        60
     ctcgttgtca cctttatgat tctcttcaac gagcgtagca ttcagcagat ccatcaccac       120
     gccgcgagtc acactcaaaa tctccgagaa ccttccacgt tcgatttcgt caagcctaat       180
     gttcctcgga ttaactactt gggagctcat gaggttttgg atagattcag caaatgcaac       240
     tcgacgaaag agtacagtgg gaagaaaatc ggatgggttg acccgtttga agaccacccg       300
     ggtcaagtaa caaaggagga gcagaaatgt gatgtctttt ctgggaaatg ggtctttgat       360
     aattcatcat catacccttt acacaaggaa tctcagtgtc cttacatgtc cgaccagttg       420
     gcttgtcaga agcatggtag gaaggatttg gagtatcagc attggagatg gcaacctcat       480
     gcctgcaact tgaagagatg gaatgcgata gaaatgtggg agaagctgag aggaaagaga       540
     ttgatgtttg ttggagactc gttaaacaga ggccaatgga tttcaatggt ttgtctctta       600
     cagtctgtca ttccacgtga caagcagtct atgtctccta acgctcacct caccattttc       660
     agggctgagg actacaatgc cacagtggag tttctctggg caccgttgct cgtggagtcg       720
     aattctgatg accctgttaa tcacagattg agcgagcgga ttatccgacc cgattctgtt       780
     cttaaacatg catcaaagtg gcaacatgct gatattctaa tcttcaacac ctacttatgg       840
     tggagacaag actctgtcaa gctccgatgg agcagtgaag aaaaagggtc atgcgaggag       900
     gtgaagagcg ccgagggaat ggagatggca atggatagtt ggggtgattg ggttgctaac       960
     aatgtcgatc caaacaaaaa gcgagttttc ttcgttacaa tgtctcctac acatcaatgg      1020
     agccgagaat ggaacccggg aagcgaagga aactgctacg gggagaagaa accaatagag      1080
     gaagagagtt attggggaag tgggtcggac attccgacaa tgaggatggt gaagagagtt      1140
     ttggagagat tgggaccaaa ggtctcagtt ataaacatca ctcagttgtc tgagtatcga      1200
     aaagatggtc atccatcggt gtaccggaaa ttctgggaac ctctaaatga agaccggttg      1260
     aaaaacccgg catcgtattc tgactgtact cattggtgtg tacctggagt tcctgatgtc      1320
     tggaatcaat tgcttttcca ttttttgtga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page