(data stored in ACNUC13479 zone)

EMBL: CP002688.PE118

CP002688.PE118       Location/Qualifiers
FT   CDS_pept        complement(join(242734..242769,243248..243448,
FT                   243923..244033))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.170"
FT                   /gene_synonym="F7A7_170"
FT                   /locus_tag="AT5G01650"
FT                   /product="Tautomerase/MIF superfamily protein"
FT                   /note="Tautomerase/MIF superfamily protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: inflammatory
FT                   response, response to other organism; LOCATED IN:
FT                   chloroplast; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Tautomerase (InterPro:IPR014347), Macrophage migration
FT                   inhibitory factor (InterPro:IPR001398); BEST Arabidopsis
FT                   thaliana protein match is: Tautomerase/MIF superfamily
FT                   protein (TAIR:AT5G57170.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01650"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M011"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL975524.1,INSD:EL977901.1,INSD:EL306996.1,
FT                   INSD:EH885476.1,INSD:BP851259.1,INSD:AI996103.1,
FT                   INSD:EG503170.1,INSD:DR211124.1,INSD:EL310221.1,
FT                   INSD:EL995482.1,INSD:AV823736.2,INSD:EH916322.1,
FT                   INSD:EG481199.1,INSD:EH941550.1,INSD:AA713318.1,
FT                   INSD:ES213204.1,INSD:BP868249.1,INSD:DR211123.1,
FT                   INSD:BP852291.1,INSD:ES068836.1,INSD:BP588414.1,
FT                   INSD:DR211122.1,INSD:EL994591.1,INSD:EL291872.1,
FT                   INSD:EL078851.1,INSD:BP802073.1,INSD:DR211112.1,
FT                   INSD:ES042723.1,INSD:EL219072.1,INSD:EG459589.1,
FT                   INSD:ES216094.1,INSD:EL267247.1,INSD:ES146690.1,
FT                   INSD:BE038533.1,INSD:ES002070.1,INSD:DR211115.1,
FT                   INSD:EL978997.1,INSD:EH928446.1,INSD:ES169934.1,
FT                   INSD:EL295164.1,INSD:EL130133.1,INSD:DR211120.1,
FT                   INSD:ES176124.1,INSD:EG472385.1,INSD:EG459588.1,
FT                   INSD:DR211107.1,INSD:AV532350.1,INSD:EL990632.1,
FT                   INSD:EG481198.1,INSD:EH991369.1,INSD:ES196376.1,
FT                   INSD:ES006297.1,INSD:EL986992.1,INSD:EL103452.1,
FT                   INSD:ES161950.1,INSD:EH869973.1,INSD:EL029951.1,
FT                   INSD:DR211116.1,INSD:ES003119.1,INSD:DR261297.1,
FT                   INSD:EL002917.1,INSD:ES021924.1,INSD:ES187411.1,
FT                   INSD:EL231807.1,INSD:EH980638.1,INSD:EL339329.1,
FT                   INSD:AV820539.1,INSD:EG472386.1,INSD:ES162861.1,
FT                   INSD:EL196164.1,INSD:DR211118.1,INSD:DR211111.1,
FT                   INSD:EL971339.1,INSD:DR211114.1,INSD:DR211106.1,
FT                   INSD:DR211117.1,INSD:AV534735.1,INSD:EG503182.1,
FT                   INSD:BP844092.1,INSD:DR211125.1,INSD:AV789394.1,
FT                   INSD:EH993777.1,INSD:DR211126.1,INSD:DR211119.1,
FT                   INSD:EL109927.1,INSD:EL136751.1,INSD:EG503171.1,
FT                   INSD:DR211110.1,INSD:EL224701.1,INSD:DR370544.1,
FT                   INSD:DR211113.1,INSD:DR211105.1,INSD:EL185350.1,
FT                   INSD:BP591041.1,INSD:EL982202.1,INSD:ES019282.1,
FT                   INSD:ES002268.1,INSD:DR211108.1,INSD:DR211121.1,
FT                   INSD:EH900018.1,INSD:F14405.1,INSD:DR378529.1,
FT                   INSD:ES110201.1,INSD:EL196546.1,INSD:ES203016.1,
FT                   INSD:EL112857.1,INSD:ES064280.1,INSD:ES068071.1,
FT                   INSD:ES023022.1,INSD:DR211109.1,INSD:EG503181.1,
FT                   INSD:DR378149.1,INSD:ES118764.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY062859.1,INSD:AY081575.1,INSD:BX833438.1,
FT                   INSD:BX830182.1,INSD:X58827.1"
FT                   /protein_id="AED90371.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   GSFFGWNGATL"
     atgccgtgcc tcaacctctc caccaacgtt aaccttgacg gcgtcgatac atcttccatt        60
     ctctcggaag cttcctccac cgtcgcgaaa atcatcggca agcctgagaa ctatgtgatg       120
     attgtcttga aaggctcagt gcctatgtca tttggcggga ccgaggatcc tgcagcttat       180
     ggtgaattag tttctatcgg tggccttaat gcggatgtga acaagaagct aagcgctgct       240
     gtttccgcca ttcttgagac taagctatcg gtgcccaagt ctcgattctt cctcaagttt       300
     tatgacacca agggatcctt ctttggttgg aacggggcga ctctttaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page