(data stored in ACNUC13479 zone)

EMBL: CP002688.PE119

CP002688.PE119       Location/Qualifiers
FT   CDS_pept        complement(join(243067..243123,243248..243448,
FT                   243923..244033))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.170"
FT                   /gene_synonym="F7A7_170"
FT                   /locus_tag="AT5G01650"
FT                   /product="Tautomerase/MIF superfamily protein"
FT                   /db_xref="GOA:F4K9G5"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G5"
FT                   /protein_id="ANM68179.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   DHQSQEYAQCLHALHQHY"
     atgccgtgcc tcaacctctc caccaacgtt aaccttgacg gcgtcgatac atcttccatt        60
     ctctcggaag cttcctccac cgtcgcgaaa atcatcggca agcctgagaa ctatgtgatg       120
     attgtcttga aaggctcagt gcctatgtca tttggcggga ccgaggatcc tgcagcttat       180
     ggtgaattag tttctatcgg tggccttaat gcggatgtga acaagaagct aagcgctgct       240
     gtttccgcca ttcttgagac taagctatcg gtgcccaagt ctcgattctt cctcaagttt       300
     tatgacacca aggaccatca aagtcaagaa tatgcacaat gtttacacgc tttacaccag       360
     cactactag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page