(data stored in ACNUC13479 zone)

EMBL: CP002688.PE120

CP002688.PE120       Location/Qualifiers
FT   CDS_pept        complement(join(243067..243123,243248..243448,
FT                   243923..244033))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.170"
FT                   /gene_synonym="F7A7_170"
FT                   /locus_tag="AT5G01650"
FT                   /product="Tautomerase/MIF superfamily protein"
FT                   /note="Tautomerase/MIF superfamily protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: inflammatory
FT                   response, response to other organism; EXPRESSED IN: 23
FT                   plant structures; EXPRESSED DURING: 13 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Tautomerase
FT                   (InterPro:IPR014347), Macrophage migration inhibitory
FT                   factor (InterPro:IPR001398); BEST Arabidopsis thaliana
FT                   protein match is: Tautomerase/MIF superfamily protein
FT                   (TAIR:AT5G57170.2); Has 820 Blast hits to 820 proteins in
FT                   207 species: Archae - 0; Bacteria - 141; Metazoa - 384;
FT                   Fungi - 26; Plants - 141; Viruses - 0; Other Eukaryotes -
FT                   128 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01650"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01650.2"
FT                   /db_xref="GOA:F4K9G5"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL975524.1,INSD:EL977901.1,INSD:ES187411.1,
FT                   INSD:EL231807.1,INSD:EH885476.1,INSD:EH980638.1,
FT                   INSD:EL339329.1,INSD:EG503170.1,INSD:EL310221.1,
FT                   INSD:EL995482.1,INSD:EL196164.1,INSD:EH916322.1,
FT                   INSD:EL971339.1,INSD:DR211114.1,INSD:DR211106.1,
FT                   INSD:AA713318.1,INSD:EG481199.1,INSD:DR211123.1,
FT                   INSD:ES213204.1,INSD:ES068836.1,INSD:EG503182.1,
FT                   INSD:EL994591.1,INSD:EL291872.1,INSD:EL078851.1,
FT                   INSD:EH993777.1,INSD:ES042723.1,INSD:EL219072.1,
FT                   INSD:EL109927.1,INSD:EL136751.1,INSD:EG503171.1,
FT                   INSD:ES216094.1,INSD:ES146690.1,INSD:ES002070.1,
FT                   INSD:EL978997.1,INSD:EH928446.1,INSD:EL185350.1,
FT                   INSD:ES169934.1,INSD:EL295164.1,INSD:EL982202.1,
FT                   INSD:EL130133.1,INSD:ES019282.1,INSD:ES002268.1,
FT                   INSD:EG459588.1,INSD:ES176124.1,INSD:EH900018.1,
FT                   INSD:DR211107.1,INSD:EL990632.1,INSD:EG481198.1,
FT                   INSD:ES110201.1,INSD:EL196546.1,INSD:ES203016.1,
FT                   INSD:EL112857.1,INSD:EH991369.1,INSD:ES064280.1,
FT                   INSD:ES196376.1,INSD:ES006297.1,INSD:EL986992.1,
FT                   INSD:EL103452.1,INSD:ES161950.1,INSD:EL029951.1,
FT                   INSD:EG503181.1,INSD:ES003119.1,INSD:ES021924.1,
FT                   INSD:EL002917.1,INSD:ES118764.1"
FT                   /protein_id="AED90372.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   DHQSQEYAQCLHALHQHY"
     atgccgtgcc tcaacctctc caccaacgtt aaccttgacg gcgtcgatac atcttccatt        60
     ctctcggaag cttcctccac cgtcgcgaaa atcatcggca agcctgagaa ctatgtgatg       120
     attgtcttga aaggctcagt gcctatgtca tttggcggga ccgaggatcc tgcagcttat       180
     ggtgaattag tttctatcgg tggccttaat gcggatgtga acaagaagct aagcgctgct       240
     gtttccgcca ttcttgagac taagctatcg gtgcccaagt ctcgattctt cctcaagttt       300
     tatgacacca aggaccatca aagtcaagaa tatgcacaat gtttacacgc tttacaccag       360
     cactactag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page