(data stored in ACNUC13479 zone)

EMBL: CP002688.PE123

CP002688.PE123       Location/Qualifiers
FT   CDS_pept        complement(join(244504..244593,244681..244870,
FT                   244969..245070,245166..245242,245548..245747,
FT                   246111..246450,246687..246764,247203..247796,
FT                   247951..248132,248325..248442))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.180"
FT                   /gene_synonym="F7A7_180"
FT                   /locus_tag="AT5G01660"
FT                   /product="influenza virus NS1A-binding protein"
FT                   /note="CONTAINS InterPro DOMAIN/s: Galactose oxidase/kelch,
FT                   beta-propeller (InterPro:IPR011043), Kelch repeat type 1
FT                   (InterPro:IPR006652), Development/cell death domain
FT                   (InterPro:IPR013989), Kelch related (InterPro:IPR013089),
FT                   Kelch-type beta propeller (InterPro:IPR015915); BEST
FT                   Arabidopsis thaliana protein match is: DCD (Development and
FT                   Cell Death) domain protein (TAIR:AT3G11000.1); Has 16133
FT                   Blast hits to 7053 proteins in 482 species: Archae - 40;
FT                   Bacteria - 1227; Metazoa - 10756; Fungi - 311; Plants -
FT                   1896; Viruses - 673; Other Eukaryotes - 1230 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01660"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013989"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES019901.1,INSD:ES059766.1"
FT                   /protein_id="AED90373.1"
FT                   /translation="MAQRRGKFSFRNLTKSQLGGVVFGCTKNTIKECMSKQLFGLPSNH
FT                   YPYVQKIDIGLPLFLFNYSDRTLHGIFEAAGCGQLNFDPYGWTSDGSERTSYPAQVPIS
FT                   VRLQCEPLSEEKFKPAIADNYYSSHHFWFELDHFQTRKLTCLLTSFAVKPKPPMNTPNT
FT                   RQIFRLISSSEKKENSDEVKPSENEPVGSLEVSLSSGGESDSSAAASHPGFSENHPDVQ
FT                   NPKQIDKDHVLEKLKDLVFSHDEHGDNSLTETVEQANIPTCKNLEDRDTLEEETCSEGK
FT                   IDGSCLVSSPLPHTISQLMHEVKELRACGLENSTKICYLEEKLDKAHKEIYQLTERCNM
FT                   LESISGPLITKAGGSDLEIHSPDDTSLDPTEAILLLGGFDKDSETWLSSVQSYFPSRNV
FT                   VKAHSSMSCIRSNASVAKLDGKIYVFGGDDGGRGWTNSAESFNQTDGQWSLCPPLNERK
FT                   GSLGGATLDGKIFAIGGGNGMVSFSDVEMLDPDIGRWIRTRSMGQERFAVASVEHKSSI
FT                   YAVGGYDGKEYLNTAERFDPREHSWMNIASMKSRRGCHSLVVLNEKLYAIGGFDGETMV
FT                   SSVEIYEPRTGTWMTGEPMKDLRGYSAVAVVKDSIYVIGGYKGEEDDILDTVECFKEGE
FT                   GWKNVPSSSIGRRCFLSAVAL"
     atggctcaaa ggaggggaaa gttttccttc agaaacctga cgaaaagtca actaggtggt        60
     gttgtctttg gctgcactaa gaataccatc aaagaatgta tgtcgaaaca gttgtttggt       120
     ttaccctcta accactatcc atacgtgcag aagattgata ttggtttgcc attgtttctt       180
     ttcaactatt ctgatcgtac acttcatggc atttttgagg ctgctggttg tggtcagctc       240
     aattttgacc cttatggctg gacctctgat ggttctgaga gaacctcata tcctgcacag       300
     gttccaatca gtgttaggtt acagtgtgaa ccactttccg aggaaaaatt caaacctgca       360
     attgcagata attactacag ttctcaccat ttttggtttg agcttgatca tttccaaaca       420
     aggaagttga catgtctgct aacatctttt gctgtgaaac ctaaaccacc catgaataca       480
     ccaaacacaa gacagatctt tcgcttgatt tcatcaagtg aaaagaaaga gaacagtgat       540
     gaggttaagc cttctgagaa tgaaccagtg ggtagcttgg aagtgtcact cagttctggc       600
     ggagaatctg actcctctgc tgctgcttct catcctggtt tctctgagaa ccatccagac       660
     gtacagaacc ccaaacaaat agataaggat catgttcttg agaaactgaa ggatctcgtc       720
     tttagtcatg atgagcatgg agacaacagt ctaactgaaa ctgttgaaca agccaacatt       780
     cccacctgca agaacttgga agacagagat acacttgaag aggaaacatg ttcagagggg       840
     aaaatagatg gcagttgtct tgtatcctct cctcttccac atacaataag ccagttgatg       900
     catgaggtga aggaactcag ggcatgcggg ctggaaaatt caaccaagat atgttacttg       960
     gaagagaagc tggacaaagc acacaaggaa atttatcaat tgacagagcg ttgcaacatg      1020
     ctggagtcca tatcaggtcc tttaatcacc aaagctggtg gcagtgattt ggagatccat      1080
     tcaccagatg ataccagctt agatccaact gaggcaattc ttcttttagg gggatttgat      1140
     aaagactctg aaacatggtt gtcatcagtg cagtcatatt ttccatccag gaatgttgta      1200
     aaggctcata gttcaatgag ctgtatccgt tcaaatgcat cagtggcaaa gttggatggt      1260
     aaaatttacg tctttggagg tgatgacggt ggccgtggct ggaccaactc agctgaatcc      1320
     tttaaccaga ctgatggcca gtggagcttg tgccccccct taaacgagcg aaaaggaagt      1380
     ttaggtggag ccactttgga tggaaaaata tttgcaatcg gaggtgggaa tgggatggta      1440
     tctttttcag atgttgagat gcttgatcca gatataggga gatggatcag aacaaggtca      1500
     atggggcagg agagatttgc agttgcgtcc gtggagcata aaagttcaat ttatgctgtc      1560
     ggtggttatg atggtaaaga gtacctgaac acagctgaaa ggtttgatcc tagagagcac      1620
     tcctggatga atattgcatc gatgaagtcg agaagaggct gccattctct tgttgttctg      1680
     aatgaaaaac tatatgcgat tggtgggttt gatggtgaga caatggtatc gagtgttgag      1740
     atatatgagc caaggacagg gacatggatg acgggagaac caatgaagga tttaagagga      1800
     tattcagcag tggcagtggt taaagactca atatatgtga tcggaggata caaaggggaa      1860
     gaggatgaca tattagacac tgttgagtgt tttaaggaag gtgaagggtg gaaaaacgtg      1920
     ccttcttcct cgatcggtag gcgttgcttt ctatctgcgg tggctttgta a               1971
//

If you have problems or comments...

PBIL Back to PBIL home page