(data stored in ACNUC13479 zone)

EMBL: CP002688.PE125

CP002688.PE125       Location/Qualifiers
FT   CDS_pept        join(252000..252143,252298..252348,252448..252690,
FT                   252762..252968,253043..253114,253186..253428,
FT                   253767..253856)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.190"
FT                   /gene_synonym="F7A7_190"
FT                   /locus_tag="AT5G01670"
FT                   /product="NAD(P)-linked oxidoreductase superfamily protein"
FT                   /note="NAD(P)-linked oxidoreductase superfamily protein;
FT                   FUNCTIONS IN: oxidoreductase activity; INVOLVED IN:
FT                   oxidation reduction; EXPRESSED IN: 18 plant structures;
FT                   EXPRESSED DURING: 11 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Aldo/keto reductase (InterPro:IPR001395),
FT                   Aldo/keto reductase subgroup (InterPro:IPR020471),
FT                   Aldo/keto reductase, conserved site (InterPro:IPR018170);
FT                   BEST Arabidopsis thaliana protein match is: NAD(P)-linked
FT                   oxidoreductase superfamily protein (TAIR:AT2G37770.2); Has
FT                   16960 Blast hits to 16922 proteins in 2239 species: Archae
FT                   - 315; Bacteria - 10569; Metazoa - 1835; Fungi - 1554;
FT                   Plants - 1108; Viruses - 0; Other Eukaryotes - 1579
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01670"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01670.2"
FT                   /db_xref="GOA:F4K9G7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:F4K9G7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP623788.1,INSD:EL065720.1,INSD:BE524891.1,
FT                   INSD:BE522549.1,INSD:BP604014.1,INSD:BP657803.1,
FT                   INSD:BE529419.1,INSD:BP642126.1,INSD:BP646310.1,
FT                   INSD:BP651268.1,INSD:BE528959.1,INSD:BE530268.1,
FT                   INSD:AU230104.1,INSD:BP828621.1"
FT                   /protein_id="AED90375.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWYTLILRKMINLSSP
FT                   LMNVLVGTCLNKRCTELSPERVRPALQNTLKELQLEYLDLYLIHWPIRLREGASKPPKA
FT                   GDVLDFDMEGVWREMENLSKDSLVRNIGVCNFTVTKLNKLLGFAELIPAVCQMEMHPGW
FT                   RNDRILEFCKKNEIHVTAYSPLGSQEGGRDLIHDQTVDRIAKKLNKTPGQILVKWGLQR
FT                   GTSVIPKSLNPERIKENIKVFDWVIPEQDFQALNSITDQKRVIDGEDLFVNKTEGPFRS
FT                   VADLWDHED"
     atggcacatg ccacgtttac gtcggaaggg cagaatatgg agtcgtttcg actcttgagt        60
     ggccacaaaa tcccagccgt tggactcggc acgtggcgat ctgggtctca agccgcccac       120
     gccgttgtca ctgcaatcgt cgagggtggc tataggcaca tagatacagc ttgggagtat       180
     ggtgatcaga gagaggtcgg tcaaggaata aagagggcga tgcacgctgg ccttgaaagg       240
     agggacctct ttgtgacctc gaagctttgg tacacattaa ttttaagaaa aatgattaat       300
     ttatcatcgc cactgatgaa tgttttggtt ggtacatgtt taaacaaaag gtgcactgag       360
     ttatctcctg agagagtgcg tcctgctctg caaaacaccc ttaaagagct tcaattagag       420
     taccttgatc tctacttgat tcactggcct atccggctaa gagaaggagc cagtaagcca       480
     ccaaaggcag gggacgttct tgactttgac atggaaggag tttggagaga aatggagaat       540
     ctttccaagg acagtctcgt caggaatatc ggtgtctgta actttacagt cactaagctc       600
     aataagctgc taggatttgc tgaactgatc cctgccgttt gccagatgga aatgcatcct       660
     ggttggagaa acgataggat actcgaattc tgcaagaaga atgagatcca tgttactgcc       720
     tattctccat tgggatctca agaaggcggg agagatctga tacacgatca gacggtggat       780
     aggatagcga agaagctgaa taagacaccg ggacagattc tagtgaaatg gggtttgcag       840
     agaggaacaa gtgtcatccc taagtcattg aatccagaga ggatcaaaga gaacatcaaa       900
     gtgtttgatt gggtgatccc tgaacaagac ttccaagctc tcaacagcat cactgaccag       960
     aaacgagtga tagacggtga ggatcttttc gtcaacaaga ccgaaggtcc attccgtagt      1020
     gtggctgatc tatgggacca tgaagactaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page