(data stored in ACNUC13479 zone)

EMBL: CP002688.PE126

CP002688.PE126       Location/Qualifiers
FT   CDS_pept        join(252000..252143,252298..252348,252448..252521,
FT                   252603..252690,252762..252968,253043..253114,
FT                   253186..253428,253767..253856)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.190"
FT                   /gene_synonym="F7A7_190"
FT                   /locus_tag="AT5G01670"
FT                   /product="NAD(P)-linked oxidoreductase superfamily protein"
FT                   /note="NAD(P)-linked oxidoreductase superfamily protein;
FT                   FUNCTIONS IN: oxidoreductase activity; INVOLVED IN:
FT                   oxidation reduction; EXPRESSED IN: 18 plant structures;
FT                   EXPRESSED DURING: 11 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Aldo/keto reductase (InterPro:IPR001395),
FT                   Aldo/keto reductase subgroup (InterPro:IPR020471),
FT                   Aldo/keto reductase, conserved site (InterPro:IPR018170);
FT                   BEST Arabidopsis thaliana protein match is: NAD(P)-linked
FT                   oxidoreductase superfamily protein (TAIR:AT2G37770.2); Has
FT                   19068 Blast hits to 19040 proteins in 2308 species: Archae
FT                   - 339; Bacteria - 12194; Metazoa - 2060; Fungi - 1600;
FT                   Plants - 1171; Viruses - 0; Other Eukaryotes - 1704
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01670"
FT                   /db_xref="GOA:Q8GXW0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GXW0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP623788.1,INSD:EL065720.1,INSD:BP836767.1,
FT                   INSD:CK121221.1,INSD:BP604014.1,INSD:BE529419.1,
FT                   INSD:BP642126.1,INSD:BE520928.1,INSD:BE525213.1,
FT                   INSD:BP651268.1,INSD:BE524761.1,INSD:BE526293.1,
FT                   INSD:BE522549.1,INSD:BP830409.1,INSD:BP657803.1,
FT                   INSD:AU238858.1,INSD:BP646310.1,INSD:BP832562.1,
FT                   INSD:BP834102.1,INSD:BE528959.1,INSD:BE520929.1,
FT                   INSD:BE530268.1,INSD:BE520689.1,INSD:BP824263.1,
FT                   INSD:BP830821.1,INSD:AU230104.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832789.1,INSD:AK118010.1,INSD:BT030096.1"
FT                   /protein_id="AED90374.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQ
FT                   NTLKELQLEYLDLYLIHWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNI
FT                   GVCNFTVTKLNKLLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEG
FT                   GRDLIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPE
FT                   QDFQALNSITDQKRVIDGEDLFVNKTEGPFRSVADLWDHED"
     atggcacatg ccacgtttac gtcggaaggg cagaatatgg agtcgtttcg actcttgagt        60
     ggccacaaaa tcccagccgt tggactcggc acgtggcgat ctgggtctca agccgcccac       120
     gccgttgtca ctgcaatcgt cgagggtggc tataggcaca tagatacagc ttgggagtat       180
     ggtgatcaga gagaggtcgg tcaaggaata aagagggcga tgcacgctgg ccttgaaagg       240
     agggacctct ttgtgacctc gaagctttgg tgcactgagt tatctcctga gagagtgcgt       300
     cctgctctgc aaaacaccct taaagagctt caattagagt accttgatct ctacttgatt       360
     cactggccta tccggctaag agaaggagcc agtaagccac caaaggcagg ggacgttctt       420
     gactttgaca tggaaggagt ttggagagaa atggagaatc tttccaagga cagtctcgtc       480
     aggaatatcg gtgtctgtaa ctttacagtc actaagctca ataagctgct aggatttgct       540
     gaactgatcc ctgccgtttg ccagatggaa atgcatcctg gttggagaaa cgataggata       600
     ctcgaattct gcaagaagaa tgagatccat gttactgcct attctccatt gggatctcaa       660
     gaaggcggga gagatctgat acacgatcag acggtggata ggatagcgaa gaagctgaat       720
     aagacaccgg gacagattct agtgaaatgg ggtttgcaga gaggaacaag tgtcatccct       780
     aagtcattga atccagagag gatcaaagag aacatcaaag tgtttgattg ggtgatccct       840
     gaacaagact tccaagctct caacagcatc actgaccaga aacgagtgat agacggtgag       900
     gatcttttcg tcaacaagac cgaaggtcca ttccgtagtg tggctgatct atgggaccat       960
     gaagactaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page