(data stored in ACNUC13479 zone)

EMBL: CP002688.PE129

CP002688.PE129       Location/Qualifiers
FT   CDS_pept        complement(join(260848..261147,261229..261452,
FT                   261583..261697,261785..262090,262289..262492))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.220"
FT                   /gene_synonym="F7A7_220"
FT                   /locus_tag="AT5G01700"
FT                   /product="Protein phosphatase 2C family protein"
FT                   /note="Protein phosphatase 2C family protein; FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, catalytic
FT                   activity; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 9 plant
FT                   structures; EXPRESSED DURING: L mature pollen stage, M
FT                   germinated pollen stage, 4 anthesis, petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s: Protein
FT                   phosphatase 2C-related (InterPro:IPR001932), Protein
FT                   phosphatase 2C (InterPro:IPR015655), Protein phosphatase
FT                   2C, N-terminal (InterPro:IPR014045); BEST Arabidopsis
FT                   thaliana protein match is: Protein phosphatase 2C family
FT                   protein (TAIR:AT5G36250.1); Has 5499 Blast hits to 5498
FT                   proteins in 290 species: Archae - 0; Bacteria - 8; Metazoa
FT                   - 1364; Fungi - 621; Plants - 2393; Viruses - 5; Other
FT                   Eukaryotes - 1108 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6NKS1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKS1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT011618.1,INSD:BT012622.1"
FT                   /protein_id="AED90379.1"
FT                   /translation="MGVCCSKGTGIIVEHGADDGNECGDGEAEVRDTNDGAVVRTRGSS
FT                   KHVSMSIKQGKKGINQDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISRHVCENLPSRV
FT                   HSKIRSSKSAGDENIENNSSQSQEELFREFEDILVTFFKQIDSELGLDSPYDSFCSGTT
FT                   AVTVFKQADCLVIANLGHSRAVLGTRSKNSFKAVQLTVDLKPCVQREAERIVSCKGRVF
FT                   AMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDVFCRKVSREDEFVVLAT
FT                   DGIWDVLSNEEVVKVVGSCKDRSVAAEMLVQRAARTWRTKFPASKADDCAVVVLYLNHR
FT                   PYPREGNVSRAISTISWRSNKSNNECYGAAPLSPLGLSQRVS"
     atgggggtct gttgtagcaa gggcacaggg ataattgtgg agcatggcgc tgatgatggt        60
     aatgaatgtg gagacggaga ggctgaggtt agggacacaa atgatggagc tgttgtaagg       120
     acgcgtggat catccaaaca cgtttccatg tcaatcaaac aagggaaaaa aggaataaat       180
     caagacgcca tgacagtctg ggagaacttt ggtggggaag aagatacgat cttttgcggt       240
     gtatttgacg gtcacggtcc catgggtcac aagatttctc gtcacgtatg tgaaaattta       300
     ccttcgaggg tccattcaaa aattagatct tccaaatctg ccggcgatga aaacatagag       360
     aataatagtt cacagagtca ggaggaactc ttccgtgaat tcgaggacat tctagtgaca       420
     ttcttcaagc aaatagacag tgaacttggt ctcgactctc cttatgatag tttttgcagc       480
     ggtacaactg ctgtaactgt ctttaaacag gctgactgtt tggtgatcgc caacttggga       540
     cattcacgag ccgttcttgg cacccgaagc aagaacagtt tcaaagctgt ccaactcacg       600
     gttgatctga aaccctgtgt ccaacgcgaa gcagagagaa tagtgtcatg caagggaagg       660
     gtgtttgcta tggaagagga acccgatgtg tatagagtgt ggatgcctga tgatgattgc       720
     ccggggctcg caatgtcaag ggcttttggt gatttctgcc tcaaagacta tggacttgtc       780
     tgcattcctg acgtcttctg cagaaaagtc agcagagaag acgagtttgt ggttctagct       840
     actgatggga tttgggatgt tttgtcaaac gaagaagtgg tgaaagttgt aggttcctgc       900
     aaggaccggt cagttgcagc tgagatgttg gttcagcgag ccgctcggac ttggagaaca       960
     aagtttccag cctcaaaagc tgatgactgt gcggtggtgg tgctttacct aaaccaccgg      1020
     ccttacccaa gagaaggaaa cgtgagccga gcaatatcaa ctatttcctg gagatcaaat      1080
     aagagcaata acgagtgtta tggagccgca ccattgtcac cattgggtct atcccaaagg      1140
     gtttcatag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page