(data stored in ACNUC13479 zone)

EMBL: CP002688.PE130

CP002688.PE130       Location/Qualifiers
FT   CDS_pept        complement(join(260848..261147,261229..261452,
FT                   261583..261697,261785..262090,262289..262345))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.220"
FT                   /gene_synonym="F7A7_220"
FT                   /locus_tag="AT5G01700"
FT                   /product="Protein phosphatase 2C family protein"
FT                   /note="Protein phosphatase 2C family protein; FUNCTIONS IN:
FT                   protein serine/threonine phosphatase activity, catalytic
FT                   activity; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: cellular_component unknown; EXPRESSED IN: 9 plant
FT                   structures; EXPRESSED DURING: L mature pollen stage, M
FT                   germinated pollen stage, 4 anthesis, petal differentiation
FT                   and expansion stage; CONTAINS InterPro DOMAIN/s: Protein
FT                   phosphatase 2C-related (InterPro:IPR001932), Protein
FT                   phosphatase 2C (InterPro:IPR015655), Protein phosphatase
FT                   2C, N-terminal (InterPro:IPR014045); BEST Arabidopsis
FT                   thaliana protein match is: Protein phosphatase 2C family
FT                   protein (TAIR:AT3G02750.2); Has 5490 Blast hits to 5489
FT                   proteins in 289 species: Archae - 0; Bacteria - 8; Metazoa
FT                   - 1364; Fungi - 619; Plants - 2389; Viruses - 5; Other
FT                   Eukaryotes - 1105 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01700"
FT                   /db_xref="GOA:Q6NKS1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKS1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX831823.1"
FT                   /protein_id="AED90378.1"
FT                   /translation="MSIKQGKKGINQDAMTVWENFGGEEDTIFCGVFDGHGPMGHKISR
FT                   HVCENLPSRVHSKIRSSKSAGDENIENNSSQSQEELFREFEDILVTFFKQIDSELGLDS
FT                   PYDSFCSGTTAVTVFKQADCLVIANLGHSRAVLGTRSKNSFKAVQLTVDLKPCVQREAE
FT                   RIVSCKGRVFAMEEEPDVYRVWMPDDDCPGLAMSRAFGDFCLKDYGLVCIPDVFCRKVS
FT                   REDEFVVLATDGIWDVLSNEEVVKVVGSCKDRSVAAEMLVQRAARTWRTKFPASKADDC
FT                   AVVVLYLNHRPYPREGNVSRAISTISWRSNKSNNECYGAAPLSPLGLSQRVS"
     atgtcaatca aacaagggaa aaaaggaata aatcaagacg ccatgacagt ctgggagaac        60
     tttggtgggg aagaagatac gatcttttgc ggtgtatttg acggtcacgg tcccatgggt       120
     cacaagattt ctcgtcacgt atgtgaaaat ttaccttcga gggtccattc aaaaattaga       180
     tcttccaaat ctgccggcga tgaaaacata gagaataata gttcacagag tcaggaggaa       240
     ctcttccgtg aattcgagga cattctagtg acattcttca agcaaataga cagtgaactt       300
     ggtctcgact ctccttatga tagtttttgc agcggtacaa ctgctgtaac tgtctttaaa       360
     caggctgact gtttggtgat cgccaacttg ggacattcac gagccgttct tggcacccga       420
     agcaagaaca gtttcaaagc tgtccaactc acggttgatc tgaaaccctg tgtccaacgc       480
     gaagcagaga gaatagtgtc atgcaaggga agggtgtttg ctatggaaga ggaacccgat       540
     gtgtatagag tgtggatgcc tgatgatgat tgcccggggc tcgcaatgtc aagggctttt       600
     ggtgatttct gcctcaaaga ctatggactt gtctgcattc ctgacgtctt ctgcagaaaa       660
     gtcagcagag aagacgagtt tgtggttcta gctactgatg ggatttggga tgttttgtca       720
     aacgaagaag tggtgaaagt tgtaggttcc tgcaaggacc ggtcagttgc agctgagatg       780
     ttggttcagc gagccgctcg gacttggaga acaaagtttc cagcctcaaa agctgatgac       840
     tgtgcggtgg tggtgcttta cctaaaccac cggccttacc caagagaagg aaacgtgagc       900
     cgagcaatat caactatttc ctggagatca aataagagca ataacgagtg ttatggagcc       960
     gcaccattgt caccattggg tctatcccaa agggtttcat ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page