(data stored in ACNUC13479 zone)

EMBL: CP002688.PE131

CP002688.PE131       Location/Qualifiers
FT   CDS_pept        complement(263709..265250)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.230"
FT                   /gene_synonym="F7A7_230"
FT                   /locus_tag="AT5G01710"
FT                   /product="methyltransferase"
FT                   /note="methyltransferases; FUNCTIONS IN: methyltransferase
FT                   activity; INVOLVED IN: metabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: sperm cell, male
FT                   gametophyte, pollen tube; EXPRESSED DURING: L mature pollen
FT                   stage, M germinated pollen stage; CONTAINS InterPro
FT                   DOMAIN/s: Methyltransferase FkbM (InterPro:IPR006342),
FT                   Methyltransferase type 11 (InterPro:IPR013216); BEST
FT                   Arabidopsis thaliana protein match is: unknown protein
FT                   (TAIR:AT3G53400.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M005"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M005"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CF773980.1,INSD:EG443085.1,INSD:EH817539.1,
FT                   INSD:BP647620.1,INSD:EL289107.1,INSD:EL181351.1,
FT                   INSD:AV540969.1,INSD:BE522910.1,INSD:EL072035.1,
FT                   INSD:W43410.1,INSD:EH982582.1,INSD:BP599580.1,
FT                   INSD:AV566181.1,INSD:BP841876.1,INSD:DR380759.1,
FT                   INSD:EL313762.1,INSD:T76053.1,INSD:EH883977.1,
FT                   INSD:AV784527.1,INSD:BE521478.1,INSD:EH953050.1,
FT                   INSD:BP865296.1,INSD:EH907257.1,INSD:BP588897.1,
FT                   INSD:BP624674.1,INSD:EL223515.1,INSD:BP598554.1,
FT                   INSD:BP593845.1,INSD:AV551908.1,INSD:EL122522.1,
FT                   INSD:EH803671.1,INSD:Z34188.1,INSD:EL991498.1,
FT                   INSD:Z34608.1,INSD:BP795867.1,INSD:CD530100.1,
FT                   INSD:AV823538.1,INSD:AV541112.1,INSD:BP846823.1,
FT                   INSD:N96523.1,INSD:DR362437.1,INSD:CB262888.1,
FT                   INSD:ES138069.1,INSD:BE521154.1,INSD:EL302614.1,
FT                   INSD:BP631664.1,INSD:EH889277.1,INSD:BP659729.1,
FT                   INSD:BP620795.1,INSD:T76061.1,INSD:ES210573.1,
FT                   INSD:BE528634.1,INSD:AI993715.1,INSD:ES020781.1,
FT                   INSD:BP592681.1,INSD:BE526422.1,INSD:EL004399.1,
FT                   INSD:DR362436.1,INSD:BE529912.1,INSD:BE526246.1,
FT                   INSD:EG443086.1,INSD:BP590806.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY056223.1,INSD:BX831689.1,INSD:BX830348.1,
FT                   INSD:AF083794.1,INSD:AY142665.1"
FT                   /protein_id="AED90380.1"
FT                   /translation="METSMGKPSFLRNIMVRVLLFGVLIIVVRFAYVVTITGESCNRGD
FT                   FCFFSLPENLNFVISGAASGSSAIDAIRSTSPGDDLYTTRDWIKSVQFYSSIFQDLIAD
FT                   GYLSPESKTLCVETAIGQEVHSLREIGVKNSVGISKKASRPLVVRGEGHAIPFEDNAFD
FT                   FVFSGGDRLGKSLKQLEFADEITRTLKPEGFAVVHVGATDTYSFNSFLDLFNSCRLVKM
FT                   RDIDGFDPSMPHIREFVIQKYSEIDGGGHHHRGGGDSGGKCWIPGYKRDLIRDAEPLIQ
FT                   EEPLKPWITLKRNIKNIKYVPSMVDIRFKSRYVYVDVGARSYGSSIGSWFKKEYPKQNK
FT                   TFDVFAIEADKAFHEEYKIKKKVNLLPYAAWVRNETLSFEINHDPGKEVEAKAKGRGMG
FT                   RIQPVKKSDSSDLAGEVNLIQGFDFADWLKKSVRERDFVVMKMDVEGTEFDLIPRLIKT
FT                   GAICLIDELFLECHYNRWQRCCPGQRSQKYNKTYNQCLELFNSLRQRGVLVHQWW"
     atggagactt ccatggggaa acccagcttc ttacggaata taatggttcg cgtgcttctc        60
     tttggtgttc ttatcatcgt tgtgagattt gcttatgttg tcaccatcac cggtgaatca       120
     tgcaatcgcg gcgacttctg cttcttctct ctccctgaga atctcaactt tgtcatctcc       180
     ggtgctgcct ccggctcttc tgctatcgac gccatcagat ctacttcccc tggggatgat       240
     ctctacacca ccagggattg gatcaaatcc gttcagtttt actcctccat cttccaggat       300
     ctgatcgccg acggttatct atcgcctgaa tcgaagacgc tttgtgtaga gacggcgatt       360
     ggacaagagg ttcactcgct cagagagatt ggggtgaaga actccgtcgg gatctctaag       420
     aaagcttcta ggccgttggt ggttagaggc gagggacatg ctattccctt tgaggataac       480
     gctttcgatt ttgtattctc cggtggtgac cgccttggga agtcgttgaa gcagttggaa       540
     ttcgccgatg agattactcg aacactgaaa cccgaagggt ttgcggtggt tcatgttggg       600
     gctacagata cgtacagttt caattcattc cttgatttgt ttaattcttg cagattggtg       660
     aagatgcgtg atatcgatgg ttttgatcct tcgatgcctc atatcagaga atttgttatt       720
     cagaaatact cagagattga tggtggtggt catcaccacc gtggtggtgg tgattctggt       780
     ggaaagtgct ggattccggg ttacaaaaga gatttgattc gggatgcaga gccactgatt       840
     caagaggagc ctcttaagcc atggattaca cttaagagga acatcaagaa tattaaatat       900
     gtgccttcta tggttgatat acgtttcaag agtagatacg tttacgttga tgttggtgct       960
     agaagttatg gatccagtat tgggagttgg ttcaagaaag agtaccctaa gcagaacaaa      1020
     acttttgatg ttttcgccat tgaggctgac aaagcctttc acgaagagta taagataaag      1080
     aagaaggtga acctgttgcc atacgcagcg tgggtgagga acgagacgtt atcgtttgag      1140
     atcaatcacg atccgggaaa ggaagtggaa gccaaagcaa agggcagggg gatgggcaga      1200
     atccagccgg ttaaaaagtc tgactcgagt gacttagctg gagaggtgaa tttgattcaa      1260
     gggtttgatt tcgctgactg gttgaagaag agtgtgagag agagggactt tgttgtgatg      1320
     aagatggatg ttgaaggaac cgaattcgat ctgatcccga ggctaatcaa gacaggagcg      1380
     atttgtctaa tagatgagtt gttccttgaa tgccattaca acaggtggca gagatgttgt      1440
     cctggtcaaa ggagccaaaa gtacaacaag acttataacc aatgcttaga gctcttcaat      1500
     tcgctcagac aaagaggggt gcttgtccat caatggtggt aa                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page