(data stored in ACNUC13479 zone)

EMBL: CP002688.PE132

CP002688.PE132       Location/Qualifiers
FT   CDS_pept        complement(join(267118..267171,267315..267566,
FT                   267657..267951,268032..268161,268247..268643,
FT                   268895..268999,269351..269476,269753..270391))
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.240"
FT                   /gene_synonym="F7A7_240"
FT                   /locus_tag="AT5G01720"
FT                   /product="RNI-like superfamily protein"
FT                   /note="RNI-like superfamily protein; FUNCTIONS IN:
FT                   ubiquitin-protein ligase activity; INVOLVED IN:
FT                   ubiquitin-dependent protein catabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 17 plant structures;
FT                   EXPRESSED DURING: 8 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Leucine-rich repeat, cysteine-containing subtype
FT                   (InterPro:IPR006553); BEST Arabidopsis thaliana protein
FT                   match is: F-box family protein (TAIR:AT5G27920.1); Has
FT                   15959 Blast hits to 6468 proteins in 357 species: Archae -
FT                   0; Bacteria - 920; Metazoa - 6194; Fungi - 1434; Plants -
FT                   4975; Viruses - 16; Other Eukaryotes - 2420 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q8RWU5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWU5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH971110.1,INSD:BP838681.1,INSD:ES157889.1,
FT                   INSD:AV831599.1,INSD:AV530096.1,INSD:ES197841.1,
FT                   INSD:EH852755.1,INSD:AV524232.1,INSD:ES141206.1,
FT                   INSD:DR349128.1,INSD:BP816558.1,INSD:BE525539.1,
FT                   INSD:AA651109.1,INSD:BP828560.1,INSD:EH993152.1,
FT                   INSD:CB252999.1,INSD:EL004558.1,INSD:AV816937.1,
FT                   INSD:BP840029.1,INSD:BP819491.1,INSD:AU230138.1,
FT                   INSD:BP827837.1,INSD:BP840154.1,INSD:AV534404.1,
FT                   INSD:AU238890.1,INSD:DR288402.1,INSD:AV534461.1,
FT                   INSD:ES193526.1,INSD:EL156940.1,INSD:DR381930.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832007.1,INSD:AY086589.1,INSD:AY091103.1,
FT                   INSD:AK229588.1,INSD:AY122938.1"
FT                   /protein_id="AED90382.1"
FT                   /translation="MKKVKQIRVLKPFDLLSEELVFIILDLISPNPSDLKSFSLTCKSF
FT                   YQLESKHRGSLKPLRSDYLPRILTRYRNTTDLDLTFCPRVTDYALSVVGCLSGPTLRSL
FT                   DLSRSGSFSAAGLLRLALKCVNLVEIDLSNATEMRDADAAVVAEARSLERLKLGRCKML
FT                   TDMGIGCIAVGCKKLNTVSLKWCVGVGDLGVGLLAVKCKDIRTLDLSYLPITGKCLHDI
FT                   LKLQHLEELLLEGCFGVDDDSLKSLRHDCKSLKKLDASSCQNLTHRGLTSLLSGAGYLQ
FT                   RLDLSHCSSVISLDFASSLKKVSALQSIRLDGCSVTPDGLKAIGTLCNSLKEVSLSKCV
FT                   SVTDEGLSSLVMKLKDLRKLDITCCRKLSRVSITQIANSCPLLVSLKMESCSLVSREAF
FT                   WLIGQKCRLLEELDLTDNEIDDEGLKSISSCLSLSSLKLGICLNITDKGLSYIGMGCSN
FT                   LRELDLYRSVGITDVGISTIAQGCIHLETINISYCQDITDKSLVSLSKCSLLQTFESRG
FT                   CPNITSQGLAAIAVRCKRLAKVDLKKCPSINDAGLLALAHFSQNLKQINVSDTAVTEVG
FT                   LLSLANIGCLQNIAVVNSSGLRPSGVAAALLGCGGLRKAKLHASLRSLLPLSLIHHLEA
FT                   RGCAFLWKDNTLQAELDPKYWKQQLEEMAP"
     atgaagaagg ttaaacagat tcgtgtctta aagcctttcg atcttctctc ggaagagctc        60
     gtctttatca tccttgacct catctctccc aacccttccg atctcaaatc cttctctctt       120
     acttgcaaat ctttctacca gctcgagtcc aagcaccgcg gatccttaaa acctctccgc       180
     tccgactatc tccctcgcat cttgactcgt taccggaaca ccaccgatct cgatcttacc       240
     ttctgcccgc gtgtcactga ctacgcgctt agcgtcgttg gctgtctctc cggacctacg       300
     cttcgctccc tcgacctctc gcgctctggc tccttctccg ccgcgggact actgcgattg       360
     gccctcaaat gtgtcaattt agtcgagatt gacctgtcca atgcgacgga gatgagagac       420
     gccgatgctg cggtggtggc ggaggcgagg agtctggaga ggctgaagct gggcagatgc       480
     aagatgctga cggacatggg aatcggatgt atagcagttg gatgtaagaa gctcaatacg       540
     gttagcttga aatggtgtgt tggcgtcgga gatttagggg ttggcttgct tgccgtcaaa       600
     tgcaaggaca ttcgcacctt agacctctcc tacttgccga tcacaggaaa gtgtttacat       660
     gacattctga aacttcaaca ccttgaagaa cttcttctag aagggtgctt tggagtagat       720
     gatgacagtc ttaaatcact cagacatgat tgcaagtcat tgaagaagct tgatgcatcc       780
     agctgccaga atttaactca tagaggttta acctcacttt taagcggggc aggatatctt       840
     cagcgacttg atctatcaca ctgttcttct gtgatatcat tggattttgc gagtagctta       900
     aagaaggttt cagcattaca gtcgatcagg ttggatggtt gttctgttac gcctgatggt       960
     ttgaaggcga taggcacatt gtgcaattcc ctgaaagagg ttagcctaag caaatgcgtg      1020
     agcgtaactg atgaaggtct ttcttctcta gtaatgaaac tgaaagacct cagaaaactt      1080
     gacatcacat gttgccggaa actaagtaga gtttcaatca cccaaatcgc caattcgtgt      1140
     cctttactag tctctttgaa gatggagtct tgttctcttg tttccagaga agccttttgg      1200
     ttgatcggac aaaagtgtcg gctacttgaa gagcttgact taactgacaa cgagattgat      1260
     gatgaaggac tgaaatccat atctagttgt ctgagtcttt cctcgttaaa gctgggaatt      1320
     tgtcttaaca taacagacaa agggctctcg tacatcggga tgggctgttc aaatctccgt      1380
     gaacttgatc tctataggtc agtgggaata acagacgtag gcatctccac aattgcccaa      1440
     ggctgcattc atctggaaac aataaacatt tcatactgcc aagacataac agacaagtcc      1500
     ctggtttcat tgtccaaatg ctcgttgtta caaacattcg agagcagggg atgtcctaac      1560
     atcacgtccc aaggacttgc agccattgct gttcggtgca agcgactcgc caaggttgac      1620
     ttgaagaagt gcccatccat caatgatgcg gggttgctcg ctctggctca cttctctcag      1680
     aatctcaaac agataaacgt gtcagacaca gctgtgactg aagtgggact tctctcccta      1740
     gccaacatag ggtgtttaca gaacatagcg gttgtgaact cgagtggttt aagaccgagc      1800
     ggagtagcag cagcattgct ggggtgtgga ggattaagga aagcgaaact acatgcgtcc      1860
     ctaagatcac tgcttcctct ttctctaatc caccacttgg aagctcgtgg ttgtgcgttc      1920
     ctctggaaag acaataccct tcaggcggag ttagatccca agtactggaa gcaacagctg      1980
     gaagagatgg cgccttaa                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page