(data stored in ACNUC13479 zone)

EMBL: CP002688.PE135

CP002688.PE135       Location/Qualifiers
FT   CDS_pept        complement(join(273019..273069,273192..273305,
FT                   273389..273475,273554..276179,276292..276353,
FT                   276490..276619,276703..276755))
FT                   /codon_start=1
FT                   /gene="SCAR4"
FT                   /gene_synonym="ATSCAR4"
FT                   /gene_synonym="F7A7.250"
FT                   /gene_synonym="F7A7_250"
FT                   /gene_synonym="SCAR family protein 4"
FT                   /gene_synonym="WAVE3"
FT                   /locus_tag="AT5G01730"
FT                   /product="SCAR family protein 4"
FT                   /db_xref="GOA:A0A1P8BBH5"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBH5"
FT                   /protein_id="ANM68917.1"
FT                   /translation="MDSYEECHGPPQLFLLDKFDVAGSGSCLKRYSDPSLLKTHTTSAV
FT                   VATSKLGKDKRLRQSKKKGSHTTIKETPEDSRTSHAKLHQLFFLEHVENGHRNPEFHVK
FT                   LKRRQLNGPPINSSSGASYMEKFLKNSSPYCERVHGTMDQSSPAMETEVTVCSEQEDLP
FT                   IPSLVYSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVVCLESSSSVNLCC
FT                   KTNNDADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQTEVLTQFSNVLR
FT                   HSPEEGESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTP
FT                   FSLSCYESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISPETHLLKVTQVPQ
FT                   DAYEGGTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALESEDISSEAGHFIP
FT                   DTKKSLNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKEDETNSQDGSSMN
FT                   PAQSKHISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANPDLAEISSYSGQE
FT                   DPQTMSIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQKELETISDPQES
FT                   LLGTEECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSVGVQSSPLDVFPS
FT                   SITEIEALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESILPLSTSLHETPQA
FT                   NPEITPPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQNGSVQANEAQYP
FT                   SEVSVTDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLNRTPEDSFSLAES
FT                   AQGLEADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKPGQTKFRQTLRDN
FT                   NSYNQNQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDENDSLLEIIRSKSFN
FT                   LRPADASGRPNFQVAVPKTNLKVAAILEKANTLRQAMAGSDDEHDSDSWSE"
     atggattcgt acgaggaatg ccatggtccg ccgcagcttt tccttctcga caagtttgat        60
     gttgctgggt ctggatcatg cttgaagcgt tactctgatc catctttatt gaagacacat       120
     actacatcag cagtagtagc aacatccaaa ctcgggaaag ataagcgact acgtcaatca       180
     aagaagaaag gatctcacac aactattaaa gagacgcctg aggattcacg gacatcacat       240
     gccaagttgc atcagctatt ctttttggag catgttgaga acggacacag aaatcctgaa       300
     ttccatgtga aactgaagag aagacagctg aatggacctc cgattaactc aagctctggg       360
     gcaagttaca tggagaaatt cctcaagaat tcttcaccat actgtgaaag agttcatggg       420
     actatggatc agtcatctcc ggcaatggaa actgaagtta cagtatgcag tgaacaagaa       480
     gacttaccaa taccttcctt agtttattcc aacagtggag gcactagaaa atacaatgag       540
     atggagatag aatccattgc tggtcatgaa atacttgaaa ttccttttgt tcctcacgag       600
     attacggtta atgagaagtc accagtggtt tgtttagaaa gtagctcttc tgtgaatttg       660
     tgttgcaaga cgaacaatga cgcagattca cctgcttcca cggagtcaga ggtaaaggaa       720
     gcagggagtg atgacaaggc tggatgtgac catggatttc caggatttgg tcagccgcag       780
     atctgtacta atgcagaagt gaatcaaaca gaggttctga ctcagttttc taatgttttg       840
     cgccactcac cggaggaagg agaatctagt cttttgtgta ctgatatcca gagagcttct       900
     cctgaaagta aaccacataa agctgaagag gctgctgtag atttagacga gtcattttcc       960
     cagatgacac cggacataga ttccgcaggc atggggactc tggagatctt acaaacacct      1020
     ttcagtttgt cttgctacga gagtcctgca aatcttcccg aagattctgg aagtcacttg      1080
     gagcttcagt ccaataaagc aaatgctgaa gcttgtgagg tctttgaagt cagaagggat      1140
     cccatgctta atatttcccc tgaaactcat cttttaaagg ttacacaagt gccacaggac      1200
     gcatatgagg gtgggaccaa tgatgttcat tctcaacatg ttttcagtgt ggagactgca      1260
     tctgagatat ctgtaagtgc tttagtggaa gaccagttct cttccataac caatcaagag      1320
     atagaggctc tggaatccga ggacatttct tctgaagctg gtcatttcat tccagatacc      1380
     aaaaagagtt taaatgaaac atcagtggca ttggagtccg attttcttct tccaaatcat      1440
     tacattagca catttgacaa ctttgaagat ttatctctgt ctgctgatgc acaggattat      1500
     gctgccccaa aagaagatga aacgaactcc caagacggat cttccatgaa tcctgcacag      1560
     tcaaaacaca tttcaacttc tgaaatcagt tcagaaaatg gaactctgat gtcagatact      1620
     ccaagagatc ttcacacagg atacgggagc ctctcagcct catcttgtct ggaagacgga      1680
     ttggccaacc ctgatctggc tgagatatca tcatattctg gacaggagga tccacaaacc      1740
     atgtctattg tttcagatga tagtagtgac cctgaggtac caattcctga tggtacttgt      1800
     tttgcaggtg atgtcgatca cgataaccag actggcctga ataataaggc cattgagacc      1860
     gtgccccaga aagaattgga aactattagt gatccacagg agagtctttt aggtacagaa      1920
     gaatgtcttt catctgagta ttgcttacag atacagaacc aaaggcaaga aagtccatca      1980
     gaaacagggt cagcaaattc aagaacatca tcagacgagt ctcctcctac acaaaatgga      2040
     tctgttggtg ttcaaagttc acctttagat gtttttcctt caagcataac tgaaatagaa      2100
     gctcttcatg caccatacca ggaaattttc acatcattaa atgatcatat ctctgagtct      2160
     gttctttcca agggtctgac tgatgaagaa gatttcttga acgtatcccc tgagtccata      2220
     ctacccctct ccacgtccct ccatgaaaca cctcaggcaa atccggagat aacacctccg      2280
     cttccgcctc ttcctccgac acaatggtgg atggggaagc tggttgaatc aaccgaaatg      2340
     ccatcacttg caggcagtgg aaacaacagt ttcaacatcc agagggatga aaacacacag      2400
     aatggatcag ttcaagcgaa cgaggcacaa tatccatcag aagtgtcggt tacagatggt      2460
     gaaaaccata attttcatat ttatacagaa gaatctaaag caaccgagga acagtctcct      2520
     tcaggagtca atgggacaag cgacacctat atggaaagta aacacaagtg tttaaataga      2580
     actccggagg attcattttc tttggcagaa tcggcccaag gcttagaagc tgactggagg      2640
     actgaagcaa tggcacttga atggtttagt cagaacttaa gagagcataa caatccccac      2700
     cctgcaaagt tagaagagga agagcctcag gttgatcacc cactagaaaa acctggacaa      2760
     accaaatttc gacaaacctt gcgagacaat aactcatata atcagaatca gaaagctgga      2820
     aagcttaaaa gagacgagga tacgcttgtt attggcattg acagaagcat gttgaggaaa      2880
     gtatctgaag ggaacaggac acacgttgga gctcgagtgg acgagaatga ttcactacta      2940
     gagatcatac ggagcaagtc gttcaacctg agaccagcag atgcctcagg gagaccaaac      3000
     tttcaagtag ctgttcccaa aaccaacttg aaggtggctg caattctaga gaaagccaac      3060
     actcttcgcc aggcaatggc gggaagtgac gacgagcacg attcagatag ctggagcgag      3120
     tga                                                                    3123
//

If you have problems or comments...

PBIL Back to PBIL home page