(data stored in ACNUC13479 zone)

EMBL: CP002688.PE138

CP002688.PE138       Location/Qualifiers
FT   CDS_pept        complement(join(273019..273069,273192..273305,
FT                   273389..273475,273554..276055))
FT                   /codon_start=1
FT                   /gene="SCAR4"
FT                   /gene_synonym="ATSCAR4"
FT                   /gene_synonym="F7A7.250"
FT                   /gene_synonym="F7A7_250"
FT                   /gene_synonym="SCAR family protein 4"
FT                   /gene_synonym="WAVE3"
FT                   /locus_tag="AT5G01730"
FT                   /product="SCAR family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01730"
FT                   /db_xref="GOA:A0A1P8BBE5"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBE5"
FT                   /protein_id="ANM68920.1"
FT                   /translation="MEKFLKNSSPYCERVHGTMDQSSPAMETEVTVCSEQEDLPIPSLV
FT                   YSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVVCLESSSSVNLCCKTNND
FT                   ADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQTEVLTQFSNVLRHSPEE
FT                   GESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDSAGMGTLEILQTPFSLSC
FT                   YESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISPETHLLKVTQVPQDAYEG
FT                   GTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALESEDISSEAGHFIPDTKKS
FT                   LNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKEDETNSQDGSSMNPAQSK
FT                   HISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANPDLAEISSYSGQEDPQTM
FT                   SIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQKELETISDPQESLLGTE
FT                   ECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSVGVQSSPLDVFPSSITEI
FT                   EALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESILPLSTSLHETPQANPEIT
FT                   PPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQNGSVQANEAQYPSEVSV
FT                   TDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLNRTPEDSFSLAESAQGLE
FT                   ADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKPGQTKFRQTLRDNNSYNQ
FT                   NQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDENDSLLEIIRSKSFNLRPAD
FT                   ASGRPNFQVAVPKTNLKVAAILEKANTLRQAMAGSDDEHDSDSWSE"
     atggagaaat tcctcaagaa ttcttcacca tactgtgaaa gagttcatgg gactatggat        60
     cagtcatctc cggcaatgga aactgaagtt acagtatgca gtgaacaaga agacttacca       120
     ataccttcct tagtttattc caacagtgga ggcactagaa aatacaatga gatggagata       180
     gaatccattg ctggtcatga aatacttgaa attccttttg ttcctcacga gattacggtt       240
     aatgagaagt caccagtggt ttgtttagaa agtagctctt ctgtgaattt gtgttgcaag       300
     acgaacaatg acgcagattc acctgcttcc acggagtcag aggtaaagga agcagggagt       360
     gatgacaagg ctggatgtga ccatggattt ccaggatttg gtcagccgca gatctgtact       420
     aatgcagaag tgaatcaaac agaggttctg actcagtttt ctaatgtttt gcgccactca       480
     ccggaggaag gagaatctag tcttttgtgt actgatatcc agagagcttc tcctgaaagt       540
     aaaccacata aagctgaaga ggctgctgta gatttagacg agtcattttc ccagatgaca       600
     ccggacatag attccgcagg catggggact ctggagatct tacaaacacc tttcagtttg       660
     tcttgctacg agagtcctgc aaatcttccc gaagattctg gaagtcactt ggagcttcag       720
     tccaataaag caaatgctga agcttgtgag gtctttgaag tcagaaggga tcccatgctt       780
     aatatttccc ctgaaactca tcttttaaag gttacacaag tgccacagga cgcatatgag       840
     ggtgggacca atgatgttca ttctcaacat gttttcagtg tggagactgc atctgagata       900
     tctgtaagtg ctttagtgga agaccagttc tcttccataa ccaatcaaga gatagaggct       960
     ctggaatccg aggacatttc ttctgaagct ggtcatttca ttccagatac caaaaagagt      1020
     ttaaatgaaa catcagtggc attggagtcc gattttcttc ttccaaatca ttacattagc      1080
     acatttgaca actttgaaga tttatctctg tctgctgatg cacaggatta tgctgcccca      1140
     aaagaagatg aaacgaactc ccaagacgga tcttccatga atcctgcaca gtcaaaacac      1200
     atttcaactt ctgaaatcag ttcagaaaat ggaactctga tgtcagatac tccaagagat      1260
     cttcacacag gatacgggag cctctcagcc tcatcttgtc tggaagacgg attggccaac      1320
     cctgatctgg ctgagatatc atcatattct ggacaggagg atccacaaac catgtctatt      1380
     gtttcagatg atagtagtga ccctgaggta ccaattcctg atggtacttg ttttgcaggt      1440
     gatgtcgatc acgataacca gactggcctg aataataagg ccattgagac cgtgccccag      1500
     aaagaattgg aaactattag tgatccacag gagagtcttt taggtacaga agaatgtctt      1560
     tcatctgagt attgcttaca gatacagaac caaaggcaag aaagtccatc agaaacaggg      1620
     tcagcaaatt caagaacatc atcagacgag tctcctccta cacaaaatgg atctgttggt      1680
     gttcaaagtt cacctttaga tgtttttcct tcaagcataa ctgaaataga agctcttcat      1740
     gcaccatacc aggaaatttt cacatcatta aatgatcata tctctgagtc tgttctttcc      1800
     aagggtctga ctgatgaaga agatttcttg aacgtatccc ctgagtccat actacccctc      1860
     tccacgtccc tccatgaaac acctcaggca aatccggaga taacacctcc gcttccgcct      1920
     cttcctccga cacaatggtg gatggggaag ctggttgaat caaccgaaat gccatcactt      1980
     gcaggcagtg gaaacaacag tttcaacatc cagagggatg aaaacacaca gaatggatca      2040
     gttcaagcga acgaggcaca atatccatca gaagtgtcgg ttacagatgg tgaaaaccat      2100
     aattttcata tttatacaga agaatctaaa gcaaccgagg aacagtctcc ttcaggagtc      2160
     aatgggacaa gcgacaccta tatggaaagt aaacacaagt gtttaaatag aactccggag      2220
     gattcatttt ctttggcaga atcggcccaa ggcttagaag ctgactggag gactgaagca      2280
     atggcacttg aatggtttag tcagaactta agagagcata acaatcccca ccctgcaaag      2340
     ttagaagagg aagagcctca ggttgatcac ccactagaaa aacctggaca aaccaaattt      2400
     cgacaaacct tgcgagacaa taactcatat aatcagaatc agaaagctgg aaagcttaaa      2460
     agagacgagg atacgcttgt tattggcatt gacagaagca tgttgaggaa agtatctgaa      2520
     gggaacagga cacacgttgg agctcgagtg gacgagaatg attcactact agagatcata      2580
     cggagcaagt cgttcaacct gagaccagca gatgcctcag ggagaccaaa ctttcaagta      2640
     gctgttccca aaaccaactt gaaggtggct gcaattctag agaaagccaa cactcttcgc      2700
     caggcaatgg cgggaagtga cgacgagcac gattcagata gctggagcga gtga            2754
//

If you have problems or comments...

PBIL Back to PBIL home page