(data stored in ACNUC13479 zone)

EMBL: CP002688.PE139

CP002688.PE139       Location/Qualifiers
FT   CDS_pept        complement(join(273165..273305,273389..273475,
FT                   273554..276179,276292..276353,276490..276619,
FT                   276703..276826,276918..277081,277407..277561))
FT                   /codon_start=1
FT                   /gene="SCAR4"
FT                   /gene_synonym="ATSCAR4"
FT                   /gene_synonym="F7A7.250"
FT                   /gene_synonym="F7A7_250"
FT                   /gene_synonym="SCAR family protein 4"
FT                   /gene_synonym="WAVE3"
FT                   /locus_tag="AT5G01730"
FT                   /product="SCAR family protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01730"
FT                   /db_xref="GOA:A0A1P8BBE6"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBE6"
FT                   /protein_id="ANM68923.1"
FT                   /translation="MALTRYQIRNEYGLADKELYQSADKEDPEALLEAASMAGLVGVLR
FT                   QLGDLSEFAAEVFHCLHEQLMTTAARGHGLAMRLQHLEADFPSVEIPILSQTDHSTFFY
FT                   EPGLEWHSDLQTKEDLISPRNLPRCIMDSYEECHGPPQLFLLDKFDVAGSGSCLKRYSD
FT                   PSLLKTHTTSAVVATSKLGKDKRLRQSKKKGSHTTIKETPEDSRTSHAKLHQLFFLEHV
FT                   ENGHRNPEFHVKLKRRQLNGPPINSSSGASYMEKFLKNSSPYCERVHGTMDQSSPAMET
FT                   EVTVCSEQEDLPIPSLVYSNSGGTRKYNEMEIESIAGHEILEIPFVPHEITVNEKSPVV
FT                   CLESSSSVNLCCKTNNDADSPASTESEVKEAGSDDKAGCDHGFPGFGQPQICTNAEVNQ
FT                   TEVLTQFSNVLRHSPEEGESSLLCTDIQRASPESKPHKAEEAAVDLDESFSQMTPDIDS
FT                   AGMGTLEILQTPFSLSCYESPANLPEDSGSHLELQSNKANAEACEVFEVRRDPMLNISP
FT                   ETHLLKVTQVPQDAYEGGTNDVHSQHVFSVETASEISVSALVEDQFSSITNQEIEALES
FT                   EDISSEAGHFIPDTKKSLNETSVALESDFLLPNHYISTFDNFEDLSLSADAQDYAAPKE
FT                   DETNSQDGSSMNPAQSKHISTSEISSENGTLMSDTPRDLHTGYGSLSASSCLEDGLANP
FT                   DLAEISSYSGQEDPQTMSIVSDDSSDPEVPIPDGTCFAGDVDHDNQTGLNNKAIETVPQ
FT                   KELETISDPQESLLGTEECLSSEYCLQIQNQRQESPSETGSANSRTSSDESPPTQNGSV
FT                   GVQSSPLDVFPSSITEIEALHAPYQEIFTSLNDHISESVLSKGLTDEEDFLNVSPESIL
FT                   PLSTSLHETPQANPEITPPLPPLPPTQWWMGKLVESTEMPSLAGSGNNSFNIQRDENTQ
FT                   NGSVQANEAQYPSEVSVTDGENHNFHIYTEESKATEEQSPSGVNGTSDTYMESKHKCLN
FT                   RTPEDSFSLAESAQGLEADWRTEAMALEWFSQNLREHNNPHPAKLEEEEPQVDHPLEKP
FT                   GQTKFRQTLRDNNSYNQNQKAGKLKRDEDTLVIGIDRSMLRKVSEGNRTHVGARVDEND
FT                   SLLEIIRSKSFNLRPADASGRPNFQVAVPKTNLKVAAILEKANTLRQVSPSLLLG"
     atggcattga cgagatacca gatacggaac gagtacggct tagcggataa ggagctctac        60
     caatccgccg ataaggagga tcctgaagct ttgctcgaag ctgcttccat ggctggtctc       120
     gtcggcgttt tgcgccagct tggcgacctc tctgagtttg ctgctgaggt attccattgc       180
     ctgcatgagc aactaatgac aactgcagca cgaggtcatg gtttggcgat gcgtctccaa       240
     cacctcgaag cagacttccc ttcagttgag atacccattc tctctcaaac cgatcattct       300
     acattctttt atgagccagg cttggaatgg cattctgatc tgcaaacaaa agaagacttg       360
     atttccccac ggaacttgcc tcgttgtata atggattcgt acgaggaatg ccatggtccg       420
     ccgcagcttt tccttctcga caagtttgat gttgctgggt ctggatcatg cttgaagcgt       480
     tactctgatc catctttatt gaagacacat actacatcag cagtagtagc aacatccaaa       540
     ctcgggaaag ataagcgact acgtcaatca aagaagaaag gatctcacac aactattaaa       600
     gagacgcctg aggattcacg gacatcacat gccaagttgc atcagctatt ctttttggag       660
     catgttgaga acggacacag aaatcctgaa ttccatgtga aactgaagag aagacagctg       720
     aatggacctc cgattaactc aagctctggg gcaagttaca tggagaaatt cctcaagaat       780
     tcttcaccat actgtgaaag agttcatggg actatggatc agtcatctcc ggcaatggaa       840
     actgaagtta cagtatgcag tgaacaagaa gacttaccaa taccttcctt agtttattcc       900
     aacagtggag gcactagaaa atacaatgag atggagatag aatccattgc tggtcatgaa       960
     atacttgaaa ttccttttgt tcctcacgag attacggtta atgagaagtc accagtggtt      1020
     tgtttagaaa gtagctcttc tgtgaatttg tgttgcaaga cgaacaatga cgcagattca      1080
     cctgcttcca cggagtcaga ggtaaaggaa gcagggagtg atgacaaggc tggatgtgac      1140
     catggatttc caggatttgg tcagccgcag atctgtacta atgcagaagt gaatcaaaca      1200
     gaggttctga ctcagttttc taatgttttg cgccactcac cggaggaagg agaatctagt      1260
     cttttgtgta ctgatatcca gagagcttct cctgaaagta aaccacataa agctgaagag      1320
     gctgctgtag atttagacga gtcattttcc cagatgacac cggacataga ttccgcaggc      1380
     atggggactc tggagatctt acaaacacct ttcagtttgt cttgctacga gagtcctgca      1440
     aatcttcccg aagattctgg aagtcacttg gagcttcagt ccaataaagc aaatgctgaa      1500
     gcttgtgagg tctttgaagt cagaagggat cccatgctta atatttcccc tgaaactcat      1560
     cttttaaagg ttacacaagt gccacaggac gcatatgagg gtgggaccaa tgatgttcat      1620
     tctcaacatg ttttcagtgt ggagactgca tctgagatat ctgtaagtgc tttagtggaa      1680
     gaccagttct cttccataac caatcaagag atagaggctc tggaatccga ggacatttct      1740
     tctgaagctg gtcatttcat tccagatacc aaaaagagtt taaatgaaac atcagtggca      1800
     ttggagtccg attttcttct tccaaatcat tacattagca catttgacaa ctttgaagat      1860
     ttatctctgt ctgctgatgc acaggattat gctgccccaa aagaagatga aacgaactcc      1920
     caagacggat cttccatgaa tcctgcacag tcaaaacaca tttcaacttc tgaaatcagt      1980
     tcagaaaatg gaactctgat gtcagatact ccaagagatc ttcacacagg atacgggagc      2040
     ctctcagcct catcttgtct ggaagacgga ttggccaacc ctgatctggc tgagatatca      2100
     tcatattctg gacaggagga tccacaaacc atgtctattg tttcagatga tagtagtgac      2160
     cctgaggtac caattcctga tggtacttgt tttgcaggtg atgtcgatca cgataaccag      2220
     actggcctga ataataaggc cattgagacc gtgccccaga aagaattgga aactattagt      2280
     gatccacagg agagtctttt aggtacagaa gaatgtcttt catctgagta ttgcttacag      2340
     atacagaacc aaaggcaaga aagtccatca gaaacagggt cagcaaattc aagaacatca      2400
     tcagacgagt ctcctcctac acaaaatgga tctgttggtg ttcaaagttc acctttagat      2460
     gtttttcctt caagcataac tgaaatagaa gctcttcatg caccatacca ggaaattttc      2520
     acatcattaa atgatcatat ctctgagtct gttctttcca agggtctgac tgatgaagaa      2580
     gatttcttga acgtatcccc tgagtccata ctacccctct ccacgtccct ccatgaaaca      2640
     cctcaggcaa atccggagat aacacctccg cttccgcctc ttcctccgac acaatggtgg      2700
     atggggaagc tggttgaatc aaccgaaatg ccatcacttg caggcagtgg aaacaacagt      2760
     ttcaacatcc agagggatga aaacacacag aatggatcag ttcaagcgaa cgaggcacaa      2820
     tatccatcag aagtgtcggt tacagatggt gaaaaccata attttcatat ttatacagaa      2880
     gaatctaaag caaccgagga acagtctcct tcaggagtca atgggacaag cgacacctat      2940
     atggaaagta aacacaagtg tttaaataga actccggagg attcattttc tttggcagaa      3000
     tcggcccaag gcttagaagc tgactggagg actgaagcaa tggcacttga atggtttagt      3060
     cagaacttaa gagagcataa caatccccac cctgcaaagt tagaagagga agagcctcag      3120
     gttgatcacc cactagaaaa acctggacaa accaaatttc gacaaacctt gcgagacaat      3180
     aactcatata atcagaatca gaaagctgga aagcttaaaa gagacgagga tacgcttgtt      3240
     attggcattg acagaagcat gttgaggaaa gtatctgaag ggaacaggac acacgttgga      3300
     gctcgagtgg acgagaatga ttcactacta gagatcatac ggagcaagtc gttcaacctg      3360
     agaccagcag atgcctcagg gagaccaaac tttcaagtag ctgttcccaa aaccaacttg      3420
     aaggtggctg caattctaga gaaagccaac actcttcgcc aggtctctcc ctctctcctt      3480
     cttggttaa                                                              3489
//

If you have problems or comments...

PBIL Back to PBIL home page