(data stored in ACNUC13479 zone)

EMBL: CP002688.PE14

CP002688.PE14        Location/Qualifiers
FT   CDS_pept        complement(join(18209..18393,18481..19449,19570..19680,
FT                   19970..20214,20358..20509,20714..20812))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.30"
FT                   /gene_synonym="F7J8_30"
FT                   /gene_synonym="LAC9"
FT                   /locus_tag="AT5G01050"
FT                   /product="Laccase/Diphenol oxidase family protein"
FT                   /note="Laccase/Diphenol oxidase family protein; FUNCTIONS
FT                   IN: laccase activity; INVOLVED IN: oxidation reduction,
FT                   lignin catabolic process; LOCATED IN: endomembrane system,
FT                   apoplast; EXPRESSED IN: root, flower; CONTAINS InterPro
FT                   DOMAIN/s: Multicopper oxidase, type 3 (InterPro:IPR011707),
FT                   Laccase (InterPro:IPR017761), Multicopper oxidase, type 2
FT                   (InterPro:IPR011706), Cupredoxin (InterPro:IPR008972),
FT                   Multicopper oxidase, type 1 (InterPro:IPR001117); BEST
FT                   Arabidopsis thaliana protein match is: laccase 8
FT                   (TAIR:AT5G01040.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFD1"
FT                   /inference="similar to RNA sequence, EST:INSD:AV548905.1"
FT                   /protein_id="AED90292.1"
FT                   /translation="MPRVHHSLSNQAFLVLLLFSSIASAAIVEHVLHVKDVVVTPLCKE
FT                   QMIPIVNGSLPGPTINVREGDTLVVHVINKSTYNVTIHWHGVFQLKSVWMDGANMITQC
FT                   PIQPSNNFTYQFDITGQEGTLLWHAHVVNLRATIHGALIIRPRSGRPYPFPKPYKEVPL
FT                   IFQQWWDTDVRLLELRPAPVSDAYLINGLAGDSYPCSKNRMFNLKVVQGKTYLLRIINA
FT                   ALNTHLFFKIANHNVTVVAVDAVYTTPYLTDVMILTPGQTIDAILTADQPIGTYYMAII
FT                   PYFSAIGVPASPDTKPTRGLIVYEGATSSSSPTKPWMPPANDIPTAHRFSSNITSLVGG
FT                   PHWTPVPRHVDEKMFITMGLGLDPCPSNAKCVGPLDQRLAGSLNNRTFMIPERISMQEA
FT                   YFYNITGVYTDDFPDQPPLKFDFTKFEQHPTNSDMEMMFPERKTSVKTIRFNSTVEIVL
FT                   QNTGILTPESHPMHLHGFNFYVLGYGFGNYDPIRDARKLNLFNPQMHNTVGVPPGGWVV
FT                   LRFIANNPGIWLFHCHMDAHLPLGIMMAFIVQNGPTRETSLPSPPSNLPQCTRDPTIYD
FT                   SRTTNVDMSY"
     atgcctcgag ttcatcattc tctgtcaaat caagccttcc tcgtccttct tctcttctct        60
     tccattgcct cagcagctat tgtcgaacat gttctccacg ttaaagacgt cgtggtgaca       120
     ccgttgtgca aggagcaaat gataccgata gttaatggaa gtcttcccgg tccaacgata       180
     aacgttagag aaggcgacac ccttgtcgtt catgtcatta acaagtcaac ttacaatgta       240
     accatccact ggcatggagt ttttcagctg aagagcgtat ggatggacgg tgcgaatatg       300
     ataactcaat gtccgattca accaagtaac aatttcacgt atcaatttga tatcaccgga       360
     caagaaggta cattgttgtg gcatgcacac gtcgttaatc tacgtgccac tattcacggg       420
     gctctaatta tccgtccccg atccggccgt ccttaccctt tccctaaacc atacaaggaa       480
     gttcctctca tttttcaaca atggtgggac acagatgtta gacttctcga actacggcca       540
     gctccggttt ctgatgctta cctcatcaat ggcctcgccg gagattcata tccttgctct       600
     aagaatagaa tgtttaacct caaagttgta caaggaaaaa catacttgct aaggattata       660
     aacgcagcac tcaacactca cctcttcttc aaaatagcca atcacaacgt tacagttgtt       720
     gctgtagatg ctgtctacac gacgccgtac ctcaccgatg tgatgatctt aacaccggga       780
     caaacaattg acgcaattct caccgctgac cagcccattg gaacgtacta catggccatc       840
     atcccttact ttagtgccat cggggtaccg gcatcccccg acaccaaacc caccagaggc       900
     ttaatcgtct acgagggtgc tacgtcatca tcatcgccaa caaagccgtg gatgcctccg       960
     gcgaatgaca tacccaccgc tcataggttc tcctcgaaca tcactagcct cgtgggtgga      1020
     cctcactgga cgccggtgcc tcgtcacgtg gacgagaaga tgttcataac gatggggctt      1080
     ggcttagacc catgtccttc gaacgccaag tgtgttggac cgttagatca aaggttagct      1140
     ggatctctaa acaaccgcac ttttatgatt ccggagagaa tctctatgca agaggcttat      1200
     ttttacaaca ttactggagt ctacactgac gattttcccg accaaccacc gcttaaattt      1260
     gatttcacaa aatttgaaca gcatcccacc aattctgaca tggagatgat gtttccggaa      1320
     agaaagacta gcgtcaagac aattagattt aattctacag tggagatcgt tttgcagaac      1380
     acgggaatac taaccccgga gagccacccc atgcaccttc acggtttcaa cttctatgtg      1440
     ttaggttatg gatttggtaa ctatgatcct attcgtgatg caagaaagct taatctattt      1500
     aacccgcaaa tgcacaatac cgttggtgta ccaccaggtg gatgggttgt cctcagattt      1560
     atcgctaata atcctggtat atggctgttc cattgtcaca tggatgcaca tttaccatta      1620
     ggaattatga tggctttcat agttcaaaat gggccaaccc gggaaacgag tttgccatct      1680
     ccaccgtcga atcttccgca atgcactcgg gatcctacga tctatgactc tcggacgact      1740
     aatgttgata tgtcttacta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page