(data stored in ACNUC13479 zone)

EMBL: CP002688.PE144

CP002688.PE144       Location/Qualifiers
FT   CDS_pept        280793..281281
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.10"
FT                   /gene_synonym="T20L15_10"
FT                   /locus_tag="AT5G01740"
FT                   /product="Nuclear transport factor 2 (NTF2) family protein"
FT                   /note="Nuclear transport factor 2 (NTF2) family protein;
FT                   CONTAINS InterPro DOMAIN/s: Wound-induced protein, Wun1
FT                   (InterPro:IPR009798); BEST Arabidopsis thaliana protein
FT                   match is: senescence associated gene 20 (TAIR:AT3G10985.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01740"
FT                   /db_xref="GOA:Q9LZX2"
FT                   /db_xref="InterPro:IPR009798"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZX2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP561180.1,INSD:AV801748.1,INSD:EL061742.1,
FT                   INSD:EL253127.1,INSD:DR381603.1,INSD:EL044656.1,
FT                   INSD:BP843349.1,INSD:BP663016.1,INSD:EH919201.1,
FT                   INSD:EL125910.1,INSD:EL299142.1,INSD:AV785326.1,
FT                   INSD:EH806022.1,INSD:EL225895.1,INSD:EH796608.1,
FT                   INSD:EL115784.1,INSD:EH935016.1,INSD:BP846951.1,
FT                   INSD:EL044843.1,INSD:EL064426.1,INSD:EH917951.1,
FT                   INSD:EL096076.1,INSD:EL135985.1,INSD:EH968314.1,
FT                   INSD:EH856352.1,INSD:EH803158.1,INSD:EL050959.1,
FT                   INSD:BP662570.1,INSD:EH833407.1,INSD:BP861266.1,
FT                   INSD:EH978411.1,INSD:BP651008.1,INSD:EL216475.1,
FT                   INSD:EL079543.1,INSD:EL288553.1,INSD:EL027171.1,
FT                   INSD:DR350255.1,INSD:EH966641.1,INSD:EL230991.1,
FT                   INSD:EL231937.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY075604.1,INSD:BT014870.1,INSD:AY089058.1"
FT                   /protein_id="AED90385.1"
FT                   /translation="MEAHNVEISTRLTPEMKNQGTIELLYKALQQGDTSTVTKVVASDV
FT                   EWWFHGPHDCQHMMRLLTGEPPRQVSFRFEPSSVQVVVPGHDCVIAEGWEGSRVYWVHV
FT                   WKLKDGVVTELREYFNTWLTVTDYSLGAVGWDMGRCTVWESVPRDLARGSLPSLLLAI"
     atggaagcac acaacgtaga gatatcaaca agacttaccc cagaaatgaa aaaccaggga        60
     accatagagt tactctacaa agcgttgcag caaggcgaca cttctacggt gaccaaagtg       120
     gtggccagtg acgtggaatg gtggttccat ggaccgcacg attgtcaaca catgatgagg       180
     ctgctaacag gggaacctcc gaggcaggtt tcgttcaggt ttgagccaag cagtgtacaa       240
     gtagtggtgc ctggtcatga ctgcgtgatt gcagaagggt gggagggttc acgcgtgtac       300
     tgggttcacg tgtggaaatt gaaagacgga gtggtcactg agctaagaga gtatttcaac       360
     acatggctca ctgttacaga ctacagtctt ggagcagtag gatgggacat ggggcgttgt       420
     acggtttggg agagcgtacc aagggacctg gctcgtggtt cgttgcctag cttgttgtta       480
     gctatttaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page