(data stored in ACNUC13479 zone)

EMBL: CP002688.PE146

CP002688.PE146       Location/Qualifiers
FT   CDS_pept        join(290034..290315,290443..290685)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.20"
FT                   /gene_synonym="T20L15_20"
FT                   /locus_tag="AT5G01750"
FT                   /product="LURP-one-like protein (DUF567)"
FT                   /note="Protein of unknown function (DUF567); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: chloroplast; EXPRESSED IN: 23 plant
FT                   structures; EXPRESSED DURING: 13 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Protein of unknown function DUF567
FT                   (InterPro:IPR007612); BEST Arabidopsis thaliana protein
FT                   match is: Protein of unknown function (DUF567)
FT                   (TAIR:AT1G33840.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01750"
FT                   /db_xref="GOA:Q9LZX1"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="PDB:1ZXU"
FT                   /db_xref="PDB:2Q4M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZX1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES140458.1,INSD:ES092266.1,INSD:DR316087.1,
FT                   INSD:EH810655.1,INSD:DR358207.1,INSD:EH911067.1,
FT                   INSD:EH980661.1,INSD:EL174033.1,INSD:T44947.1,
FT                   INSD:EL215332.1,INSD:EH828907.1,INSD:DR358203.1,
FT                   INSD:EL196476.1,INSD:EL160892.1,INSD:EH913881.1,
FT                   INSD:ES142402.1,INSD:AV553247.1,INSD:EL991652.1,
FT                   INSD:EL066272.1,INSD:EL993803.1,INSD:BP822864.1,
FT                   INSD:DR259602.1,INSD:EL316666.1,INSD:CB263328.1,
FT                   INSD:EL228909.1,INSD:ES166032.1,INSD:EL155019.1,
FT                   INSD:EL285042.1,INSD:DR350571.1,INSD:EL117135.1,
FT                   INSD:BP855110.1,INSD:T42596.1,INSD:CB260128.1,
FT                   INSD:EL262512.1,INSD:EL175224.1,INSD:ES115316.1,
FT                   INSD:DR358206.1,INSD:EL104647.1,INSD:EL136622.1,
FT                   INSD:BP807051.1,INSD:EL164658.1,INSD:W43248.1,
FT                   INSD:ES075885.1,INSD:EH991836.1,INSD:BP822838.1,
FT                   INSD:ES017732.1,INSD:EH882905.1,INSD:EH822048.1,
FT                   INSD:ES096397.1,INSD:EL276194.1,INSD:EL983879.1,
FT                   INSD:EH836588.1,INSD:BE038953.1,INSD:BP852115.1,
FT                   INSD:DR358204.1,INSD:EH811841.1,INSD:EL332416.1,
FT                   INSD:ES195211.1,INSD:BP829010.1,INSD:EH925056.1,
FT                   INSD:EL080306.1,INSD:ES125222.1,INSD:BP833555.1,
FT                   INSD:BP853304.1,INSD:CB254258.1,INSD:ES123471.1,
FT                   INSD:EL270096.1,INSD:BP831152.1,INSD:ES157246.1,
FT                   INSD:ES122880.1,INSD:EL254238.1,INSD:EL312705.1,
FT                   INSD:BP821217.1,INSD:EL017720.1,INSD:EL163467.1,
FT                   INSD:EL266955.1,INSD:BP860061.1,INSD:DR316088.1,
FT                   INSD:EG419797.1,INSD:ES072927.1,INSD:DR259603.1,
FT                   INSD:EG419786.1,INSD:Z34868.1,INSD:R30135.1,
FT                   INSD:BP820367.1,INSD:BP828347.1,INSD:AV526198.1,
FT                   INSD:AV554258.1,INSD:AA721870.1,INSD:ES101816.1,
FT                   INSD:AV553580.1,INSD:EL213022.1,INSD:DR372338.1,
FT                   INSD:ES097621.1,INSD:DR358209.1,INSD:DR259604.1,
FT                   INSD:EL254036.1,INSD:EL314953.1,INSD:EL274893.1,
FT                   INSD:EL099481.1,INSD:CB262288.1,INSD:T42564.1,
FT                   INSD:EH850293.1,INSD:N37667.1,INSD:EL212695.1,
FT                   INSD:EH839936.1,INSD:EL260736.1,INSD:EH978623.1,
FT                   INSD:EH871421.1,INSD:AV536937.1,INSD:EH873326.1,
FT                   INSD:ES025939.1,INSD:BP831850.1,INSD:EL197381.1,
FT                   INSD:T46542.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:AY085369.1"
FT                   /protein_id="AED90386.1"
FT                   /translation="MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPKYCAPYPIDMAIVRK
FT                   MMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQV
FT                   FRGGSTDQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGE
FT                   SDAIVAQVYYL"
     atggagcagc cgtacgtgta cgcatacccg caaggtagtg gcccctcggg agctccgact        60
     ccacaagccg gaggagtggt agtggatcca aagtactgcg ctccttaccc tatagatatg       120
     gcgatcgtac ggaagatgat gtcgttaacg gacggcaatt tcgtgataac ggacgtcaac       180
     ggaaacctgc tgttcaaggt gaaggaaccg gtgtttggtc tccacgacaa gagggtcttg       240
     ctggatggtt ctggtactcc ggtcgtcact ttgagagaaa agatggtgag catgcatgac       300
     aggtggcaag tgtttagagg agggagtacg gatcagcgtg atctgctgta cacggtgaaa       360
     agatcgtcga tgcttcagct aaagaccaaa ctcgatgtgt ttttgggaca caacaaagat       420
     gagaagagat gtgatttcag agtcaaaggg agttggctcg agcgttcttg tgttgtttac       480
     gccggcgaat ctgacgccat tgttgcccaa gtatactatc tctaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page