(data stored in ACNUC13479 zone)

EMBL: CP002688.PE147

CP002688.PE147       Location/Qualifiers
FT   CDS_pept        join(291753..291913,292000..292078,292175..292273,
FT                   292393..292506,292582..292745,292838..292919,
FT                   293013..293098,293200..293466,293551..294127)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.30"
FT                   /gene_synonym="T20L15_30"
FT                   /locus_tag="AT5G01760"
FT                   /product="ENTH/VHS/GAT family protein"
FT                   /note="ENTH/VHS/GAT family protein; FUNCTIONS IN: protein
FT                   transporter activity; INVOLVED IN: intracellular protein
FT                   transport, intra-Golgi vesicle-mediated transport; LOCATED
FT                   IN: Golgi stack, intracellular; CONTAINS InterPro DOMAIN/s:
FT                   VHS (InterPro:IPR002014), GAT (InterPro:IPR004152), VHS
FT                   subgroup (InterPro:IPR018205), ENTH/VHS
FT                   (InterPro:IPR008942); BEST Arabidopsis thaliana protein
FT                   match is: ENTH/VHS/GAT family protein (TAIR:AT2G38410.1);
FT                   Has 1737 Blast hits to 1724 proteins in 203 species: Archae
FT                   - 0; Bacteria - 8; Metazoa - 865; Fungi - 471; Plants -
FT                   276; Viruses - 2; Other Eukaryotes - 115 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:F4KAU9"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR038425"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4KAU9"
FT                   /inference="similar to RNA sequence, EST:INSD:AU230780.1"
FT                   /protein_id="AED90388.1"
FT                   /translation="MRPSCASSSSSSASPSLRLSSVTVAVDKATSELLRTPDWTIIIAI
FT                   CDSLNSNRWQCKDAIKAVKRRLQHKSSRVQLLTLTLLEAMLKNCGDFVHSHIAEKHLLE
FT                   DMVKLVRKKGDFEVRNKLLILLDTWNEAFSGVACKHPHYNWAYQELKRCGVKFPQRSKE
FT                   APLMLEPPPPVTQSSSSSSMNLMSIGSFRRLDETMATEIESLSLSSLESMRNVMDLVND
FT                   MVQAVNPSDKSALKDELIVDLVEQCRSNQKKLIQMLTTTADEDVLARGLELNDSLQVVL
FT                   ARHDAIASGVSLPLLLQAPEPRETSSSLKTCGAAALESADSESSSSSSSSESETDEVED
FT                   VKDDFIQLAKRHALLNALHSDEEEETLLLGNDNEKTAEAEAKTQCKDLALFDTTTTTTT
FT                   KSEQDIIELLSLTLSTTALPSPQTQPQTQHPSFFADDNILMNSYVVPWAQSQEEPQVPK
FT                   MTQFAPSGPQFQPWPLQQQQPYSYGYPQPQWSGGQVNSNDTTFWSQGGNENMVFERNLQ
FT                   VSNSFPARATGTSGAATAATVDRQP"
     atgaggcctt cttgtgcttc ttcctcctcc tcctctgctt ctccttcgtt gaggctatcg        60
     tcagtgacag tggcggtgga caaagccacg agcgagcttc tccgcactcc tgattggacc       120
     atcatcatcg ccatctgcga ttctctcaat tctaatcgct ggcaatgcaa agatgccatc       180
     aaagccgtga agagaagatt gcagcacaag agttctagag ttcaattact cactttaacg       240
     ttgttggagg caatgctgaa gaactgcggt gactttgtgc attctcatat cgctgagaaa       300
     catcttcttg aagatatggt taagcttgtc aggaaaaagg gtgattttga agtaaggaac       360
     aaactcttga ttttgttgga tacatggaat gaagcattca gtggagttgc ttgcaaacac       420
     cctcactaca actgggcata ccaagagctt aaacggtgtg gtgtgaaatt tccacaacgt       480
     tcgaaagaag cacccctgat gcttgaacca ccacctccag tgacacagtc ttcttcctct       540
     tcttctatga atttaatgtc cattggctca tttagaaggc ttgacgaaac tatggctaca       600
     gaaattgaga gcttaagctt atcaagcctt gaatccatga gaaatgtgat ggatcttgtg       660
     aatgacatgg ttcaagccgt taatccttct gataaatcag ccttaaaaga tgagctaata       720
     gttgatctag tagagcagtg cagatctaat cagaagaaac taatccagat gctcactaca       780
     actgcggacg aggatgttct ggcacgtggt ctcgagctga atgactcttt gcaggtagtg       840
     ctcgctagac acgacgctat tgcctctggc gtctctcttc ctttgttgtt gcaggcccca       900
     gagccaagag agacaagctc ttccctcaag acttgtggtg ctgctgctct tgagtctgct       960
     gactctgagt cttcttcatc atcatcgagc agtgaaagtg aaacagatga agtggaggat      1020
     gttaaagatg actttataca gctagccaaa aggcatgctc tattaaatgc cctacacagc      1080
     gatgaagaag aagaaacatt gcttctaggc aacgacaatg aaaaaacagc agaagcagaa      1140
     gccaagacac agtgcaaaga tctagctttg ttcgacacaa caacaacaac aaccaccaag      1200
     tcagagcagg atattattga acttctcagc ctaactctgt caacaactgc tctgccctcc      1260
     ccacaaacgc aaccgcagac gcagcaccca tcgttttttg ctgatgataa tattcttatg      1320
     aacagctacg ttgtcccctg ggcacagtcc caagaagaac cacaagtccc aaaaatgact      1380
     cagtttgctc catcaggacc tcagtttcag ccatggcctc tgcagcagca acaaccgtat      1440
     tcatacggtt atcctcagcc acaatggagc ggtggccaag taaacagtaa tgacacaaca      1500
     ttctggagcc aaggaggcaa tgagaatatg gtctttgaga gaaacttgca agtctcaaac      1560
     tcatttcctg ctagagccac gggcacatcc ggtgctgcta ctgcggctac agtggacagg      1620
     cagccgtag                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page