(data stored in ACNUC13479 zone)

EMBL: CP002688.PE149

CP002688.PE149       Location/Qualifiers
FT   CDS_pept        complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295728,
FT                   295828..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297896,297996..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300603,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:A0A1P8BAR8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAR8"
FT                   /protein_id="ANM68698.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAEGESSGPPKDCILLAACDVHETLPQSVEFPADVF
FT                   TSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIA
FT                   WNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWDAWD
FT                   MAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLL
FT                   SQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTKILA
FT                   LDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEANLI
FT                   AVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASEKLIPLLSEA
FT                   QPEVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPLVRT
FT                   EVAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGSLTR
FT                   ASPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQPRPL
FT                   DNAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASASHT
FT                   PLAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPDSGL
FT                   ADPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEHIAK
FT                   CQHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNG
FT                   FDNNDFPDKGISNLCLVNELDDSLLLVASCDGSVRIWKDYATKGRQKLVTGFSSIQGQK
FT                   PGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTALSASQVH
FT                   GSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIVSASQAGD
FT                   IQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGEQLGIIKY
FT                   HTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     atggcattag gggacttgat ggtctccagg ctctctcaat cttccgttac tgttgtcacc        60
     aatcacctct acgacgacga cgacaactgc gcctcctccg ctcacgatga ttcccgtgtg       120
     tccatcatcg cctctcccag agtcgcaagt agcagctatg agaacctctc cgccgccaca       180
     agcatggcat acttgcctca gactcttgtg ctctgtgacc ttagacacga cgacgcatcc       240
     gacatcgtcc aacccccaag atggcgcctt aaagagcgaa tgaaaacagg atgtgttgct       300
     ctagttatgt gtttgcacat tactgttgat ccccctgatg ttattaagat ttctccctgc       360
     gcaagactcg aatgctggat agatcctttt tctatgtttc ccccaagaag agctcttgag       420
     gctattggcc aaaacttgag cattcagtac gagagatggc tggctcgggc tcgatataaa       480
     gtcgaattgg atcctacaaa ggacgatgtc aggaagctct gcttgtcttg ccggaaatat       540
     gcaaagactg agagagtttt gtttcactat aacgggcatg gtgtccctaa acctacacct       600
     aatggtgaaa tctgggttta caataagaat tttacgcagt acattccctt gccagtcagc       660
     gagcttgatt cctggttgaa aacacccacc atttacgttt ttgactgctc tgctgctagg       720
     gtgatcctca atgccttcgc cgagggggaa tcttctggac ccccgaagga ctgtattcta       780
     ctggctgctt gtgatgtaca tgagacactt cctcagagtg ttgaatttcc agctgacgtt       840
     tttacttctt gcctcacaac acctattaat atcgcattga aatggttctg cagacgttct       900
     cttctgaaag aatttataga tgaatcactt attgatagaa ttcccggtcg ccaaaatgac       960
     cgtaaaacat tgttaggaga gttgaactgg atcttcactg cagtcacaga caccattgcc      1020
     tggaatgtgc ttccacgcga acttttccag agattattca gacaggactt gttggttgct      1080
     agccttttcc gaaatttctt actagctgag aggataatgc ggtccggaaa ttgtacccca      1140
     atatcacatc ctatgctacc tcctacgcat cagcatcata tgtgggatgc atgggacatg      1200
     gctgctgaaa tctgcctttc tcagcttcct caattttttc tggacccaaa tacggagttt      1260
     cagccaagtt catttttcac tgagcaactg acagcttttg aggtctggct ggatcatgga      1320
     tctgagcata agaagccacc agagcagtta cctattgttc ttcaggtctt acttagccag      1380
     tgccatcggt atcgtgctct ggtgcttctt ggaagatttc ttgatatggg tccttgggct      1440
     gtcgatttgg ccttatctgt tggaatatat ccttgcgtag tgaagctgct gcaaacaaca      1500
     actattgagc tacggcagat tcttgttttc atatggacaa agatcctagc acttgataag      1560
     tcctgtcaag ttgatcttgt gaaggaccgg ggccacatat atttcattcg atttttagat      1620
     agttctgatg cattcccaga acaacgtgct atggctgcgt ttattttggc tgttattgtc      1680
     gatggctaca aacgaggcca agaatcatgt cttgaagcta atttaattgc tgtttgtctg      1740
     gggcacctcg aagcaaccca actatgtgat ccaccgccag aaccattgtt tctacaatgg      1800
     ctttgtcttt gtcttggaaa gttgtgggag gactatttgg aggcccagat aatgggtagg      1860
     gaggcaaatg cttctgagaa gttgatacct ctgctttccg aggcccaacc agaggtcagg      1920
     gctgctgctg tttttgcctt gggtacctta cttgatgttg ggtttgactc tggtaaaggt      1980
     gtttgtgatg aagaatttga tgatgatgaa aatatagttg aagatattat cataaaaagt      2040
     ctcttagatg tagtttcaga tgggagcccg cttgtccgaa cagaggttgc tgtagctctc      2100
     gcacggtttg cttttggaca caaacaacat ctaaagtcag ttgcagattc atactggaag      2160
     ccccaaaatt ctctgcgaac ttctctccct tcaatggcca agtttcatga ctctgggact      2220
     tcaatagttg cttcttcaga catgggttct ctgactagag ctagccctga tagccaacca      2280
     gtggctcgtg aaggaaggat ctcaagcagc ctccaagaac ctttttccgg gctaatgcaa      2340
     ggatctccat tagctgatga ctcctccttg cattctgatg ttggaatcat ccatgatggt      2400
     gtcagcaatg gagttgtcca tcagccaaga ccgctggata atgctatcta ttcgcagagt      2460
     gttctagcta tgtttacctt agctaaagat ccatctccac gtattgcaag ccttgggcgg      2520
     cgtgtgcttt ctgttattgg gattgaacaa attgttgcga aaccctccaa gtccaatggc      2580
     cgaccaggtg aagcagcatc agcatctcac actcctctgg ctggcctagt tcgctcatcc      2640
     tcttggtttg acatgcatac aggccaccta ccgttaacat ttaggactcc tccggtaagc      2700
     cctccgcaaa caagctattt aactggactg aggagagttt gttcgctaga gctccgacct      2760
     catctgctgg gttctcccga ctctggattg gctgatccga ttttaggtgt aagcgggtct      2820
     gaacggagtt tgcttccaca atcaactatc tacaactgga gctgtggtca cttttccaaa      2880
     cctcttcttg gcggagcaga tgctaatgaa gagatagcag cccaaagaga agaaaaaaaa      2940
     aagttttcgc tggagcatat tgcaaaatgc cagcattcat caataagcgg gctcagcaat      3000
     attccgattg ctaattggga tacaaagttt gaaacgggaa caaagacggc cctccttcac      3060
     cctttttctc ctattgtagt tgctgccgat gagaatgaac ggattagggt gtggaattac      3120
     gaggaagcaa ctcttcttaa tggctttgac aataacgatt ttcctgacaa aggaatttca      3180
     aatctctgcc ttgtcaatga acttgatgac tctctgctac ttgttgcctc ttgcgatgga      3240
     tcagtccgta tatggaaaga ctacgcaaca aagggtagac aaaaacttgt cacagggttt      3300
     tcgtcaatcc aaggtcagaa gcctggtgca agtggcctga acgctgtcgt ggactggcaa      3360
     caacagtcag gttacctgta tgtttctggg gaatcgttat caatcatggt ttgggacctg      3420
     gataaagaac agctcgtcaa atctatgccc tttgaatccg ggtgcagcgt cacagccctt      3480
     tcggcttctc aagtgcatgg gagtcaactt gctgctggtt ttgcggatgg atctgtaaga      3540
     ctctacgacg ttcgcacacc tgactttctt gtgtgcgcca ctcggcctca tcagcgagta      3600
     gaaaaagtag ttggactcag ctttcagcct ggactcgatc cagcaaagat tgtgagcgca      3660
     tcacaagcag gtgacattca gtttctggat ctgagaagac caaaggagac atacctgact      3720
     atagacgcgc atagaggatc actgacagca ttgggtgttc atagacatgc tccaatcata      3780
     gcgagcgggt cagcaaaaca gctaataaaa gtgttcagcc ttaaaggaga gcaacttggg      3840
     atcataaagt accacacttc cttcatgggc caacagattg gcccagtcag ttgcctcgcc      3900
     tttcaccctt accagatgtt gttagccgca ggggctgctg gctccttcgt ctccttatac      3960
     acccaccaca acacacaatt accaagatag                                       3990
//

If you have problems or comments...

PBIL Back to PBIL home page