(data stored in ACNUC13479 zone)

EMBL: CP002688.PE150

CP002688.PE150       Location/Qualifiers
FT   CDS_pept        complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295728,
FT                   295828..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297927,298030..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300612,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:A0A1P8BAS5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAS5"
FT                   /protein_id="ANM68699.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAELHEGESSGPPKDCILLAACDVHETLPQSVEFPA
FT                   DVFTSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTD
FT                   TIAWNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWD
FT                   AWDMAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQ
FT                   VLLSQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTK
FT                   ILALDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEA
FT                   NLIAVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASENLIAGH
FT                   TNLLQVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPLV
FT                   RTEVAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGSL
FT                   TRASPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQPR
FT                   PLDNAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASAS
FT                   HTPLAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPDS
FT                   GLADPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEHI
FT                   AKCQHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLL
FT                   NGFDNNDFPDKGISNLCLVNELDDSLLLVASCDGSVRIWKDYATKGRQKLVTGFSSIQG
FT                   QKPGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTALSASQ
FT                   VHGSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIVSASQA
FT                   GDIQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGEQLGII
FT                   KYHTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     atggcattag gggacttgat ggtctccagg ctctctcaat cttccgttac tgttgtcacc        60
     aatcacctct acgacgacga cgacaactgc gcctcctccg ctcacgatga ttcccgtgtg       120
     tccatcatcg cctctcccag agtcgcaagt agcagctatg agaacctctc cgccgccaca       180
     agcatggcat acttgcctca gactcttgtg ctctgtgacc ttagacacga cgacgcatcc       240
     gacatcgtcc aacccccaag atggcgcctt aaagagcgaa tgaaaacagg atgtgttgct       300
     ctagttatgt gtttgcacat tactgttgat ccccctgatg ttattaagat ttctccctgc       360
     gcaagactcg aatgctggat agatcctttt tctatgtttc ccccaagaag agctcttgag       420
     gctattggcc aaaacttgag cattcagtac gagagatggc tggctcgggc tcgatataaa       480
     gtcgaattgg atcctacaaa ggacgatgtc aggaagctct gcttgtcttg ccggaaatat       540
     gcaaagactg agagagtttt gtttcactat aacgggcatg gtgtccctaa acctacacct       600
     aatggtgaaa tctgggttta caataagaat tttacgcagt acattccctt gccagtcagc       660
     gagcttgatt cctggttgaa aacacccacc atttacgttt ttgactgctc tgctgctagg       720
     gtgatcctca atgccttcgc cgagcttcac gagggggaat cttctggacc cccgaaggac       780
     tgtattctac tggctgcttg tgatgtacat gagacacttc ctcagagtgt tgaatttcca       840
     gctgacgttt ttacttcttg cctcacaaca cctattaata tcgcattgaa atggttctgc       900
     agacgttctc ttctgaaaga atttatagat gaatcactta ttgatagaat tcccggtcgc       960
     caaaatgacc gtaaaacatt gttaggagag ttgaactgga tcttcactgc agtcacagac      1020
     accattgcct ggaatgtgct tccacgcgaa cttttccaga gattattcag acaggacttg      1080
     ttggttgcta gccttttccg aaatttctta ctagctgaga ggataatgcg gtccggaaat      1140
     tgtaccccaa tatcacatcc tatgctacct cctacgcatc agcatcatat gtgggatgca      1200
     tgggacatgg ctgctgaaat ctgcctttct cagcttcctc aattttttct ggacccaaat      1260
     acggagtttc agccaagttc atttttcact gagcaactga cagcttttga ggtctggctg      1320
     gatcatggat ctgagcataa gaagccacca gagcagttac ctattgttct tcaggtctta      1380
     cttagccagt gccatcggta tcgtgctctg gtgcttcttg gaagatttct tgatatgggt      1440
     ccttgggctg tcgatttggc cttatctgtt ggaatatatc cttgcgtagt gaagctgctg      1500
     caaacaacaa ctattgagct acggcagatt cttgttttca tatggacaaa gatcctagca      1560
     cttgataagt cctgtcaagt tgatcttgtg aaggaccggg gccacatata tttcattcga      1620
     tttttagata gttctgatgc attcccagaa caacgtgcta tggctgcgtt tattttggct      1680
     gttattgtcg atggctacaa acgaggccaa gaatcatgtc ttgaagctaa tttaattgct      1740
     gtttgtctgg ggcacctcga agcaacccaa ctatgtgatc caccgccaga accattgttt      1800
     ctacaatggc tttgtctttg tcttggaaag ttgtgggagg actatttgga ggcccagata      1860
     atgggtaggg aggcaaatgc ttctgagaat ctaattgctg gccacaccaa tctcttgcag      1920
     gtcagggctg ctgctgtttt tgccttgggt accttacttg atgttgggtt tgactctggt      1980
     aaaggtgttt gtgatgaaga atttgatgat gatgaaaata tagttgaaga tattatcata      2040
     aaaagtctct tagatgtagt ttcagatggg agcccgcttg tccgaacaga ggttgctgta      2100
     gctctcgcac ggtttgcttt tggacacaaa caacatctaa agtcagttgc agattcatac      2160
     tggaagcccc aaaattctct gcgaacttct ctcccttcaa tggccaagtt tcatgactct      2220
     gggacttcaa tagttgcttc ttcagacatg ggttctctga ctagagctag ccctgatagc      2280
     caaccagtgg ctcgtgaagg aaggatctca agcagcctcc aagaaccttt ttccgggcta      2340
     atgcaaggat ctccattagc tgatgactcc tccttgcatt ctgatgttgg aatcatccat      2400
     gatggtgtca gcaatggagt tgtccatcag ccaagaccgc tggataatgc tatctattcg      2460
     cagagtgttc tagctatgtt taccttagct aaagatccat ctccacgtat tgcaagcctt      2520
     gggcggcgtg tgctttctgt tattgggatt gaacaaattg ttgcgaaacc ctccaagtcc      2580
     aatggccgac caggtgaagc agcatcagca tctcacactc ctctggctgg cctagttcgc      2640
     tcatcctctt ggtttgacat gcatacaggc cacctaccgt taacatttag gactcctccg      2700
     gtaagccctc cgcaaacaag ctatttaact ggactgagga gagtttgttc gctagagctc      2760
     cgacctcatc tgctgggttc tcccgactct ggattggctg atccgatttt aggtgtaagc      2820
     gggtctgaac ggagtttgct tccacaatca actatctaca actggagctg tggtcacttt      2880
     tccaaacctc ttcttggcgg agcagatgct aatgaagaga tagcagccca aagagaagaa      2940
     aaaaaaaagt tttcgctgga gcatattgca aaatgccagc attcatcaat aagcgggctc      3000
     agcaatattc cgattgctaa ttgggataca aagtttgaaa cgggaacaaa gacggccctc      3060
     cttcaccctt tttctcctat tgtagttgct gccgatgaga atgaacggat tagggtgtgg      3120
     aattacgagg aagcaactct tcttaatggc tttgacaata acgattttcc tgacaaagga      3180
     atttcaaatc tctgccttgt caatgaactt gatgactctc tgctacttgt tgcctcttgc      3240
     gatggatcag tccgtatatg gaaagactac gcaacaaagg gtagacaaaa acttgtcaca      3300
     gggttttcgt caatccaagg tcagaagcct ggtgcaagtg gcctgaacgc tgtcgtggac      3360
     tggcaacaac agtcaggtta cctgtatgtt tctggggaat cgttatcaat catggtttgg      3420
     gacctggata aagaacagct cgtcaaatct atgccctttg aatccgggtg cagcgtcaca      3480
     gccctttcgg cttctcaagt gcatgggagt caacttgctg ctggttttgc ggatggatct      3540
     gtaagactct acgacgttcg cacacctgac tttcttgtgt gcgccactcg gcctcatcag      3600
     cgagtagaaa aagtagttgg actcagcttt cagcctggac tcgatccagc aaagattgtg      3660
     agcgcatcac aagcaggtga cattcagttt ctggatctga gaagaccaaa ggagacatac      3720
     ctgactatag acgcgcatag aggatcactg acagcattgg gtgttcatag acatgctcca      3780
     atcatagcga gcgggtcagc aaaacagcta ataaaagtgt tcagccttaa aggagagcaa      3840
     cttgggatca taaagtacca cacttccttc atgggccaac agattggccc agtcagttgc      3900
     ctcgcctttc acccttacca gatgttgtta gccgcagggg ctgctggctc cttcgtctcc      3960
     ttatacaccc accacaacac acaattacca agatag                                3996
//

If you have problems or comments...

PBIL Back to PBIL home page