(data stored in ACNUC13479 zone)

EMBL: CP002688.PE151

CP002688.PE151       Location/Qualifiers
FT   CDS_pept        complement(join(294539..294880,294961..295042,
FT                   295152..295237,295386..295487,295583..295728,
FT                   295828..295952,296266..296392,296485..296802,
FT                   296909..297475,297716..297896,297996..298349,
FT                   298667..298777,298881..298964,299183..299284,
FT                   299378..299456,299537..299681,299813..299967,
FT                   300464..300612,300703..300819,300902..301060,
FT                   301140..301225,301317..301419,301495..301773))
FT                   /codon_start=1
FT                   /gene="RAPTOR2"
FT                   /gene_synonym="ATRAPTOR1A"
FT                   /gene_synonym="RAPTOR1A"
FT                   /gene_synonym="T20L15.40"
FT                   /gene_synonym="T20L15_40"
FT                   /locus_tag="AT5G01770"
FT                   /product="regulatory-associated protein of TOR 2 (RAPTOR2)"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01770"
FT                   /db_xref="GOA:A0A1P8BAT3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAT3"
FT                   /protein_id="ANM68696.1"
FT                   /translation="MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIAS
FT                   PRVASSSYENLSAATSMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMC
FT                   LHITVDPPDVIKISPCARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVEL
FT                   DPTKDDVRKLCLSCRKYAKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSEL
FT                   DSWLKTPTIYVFDCSAARVILNAFAELHEGESSGPPKDCILLAACDVHETLPQSVEFPA
FT                   DVFTSCLTTPINIALKWFCRRSLLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTD
FT                   TIAWNVLPRELFQRLFRQDLLVASLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWD
FT                   AWDMAAEICLSQLPQFFLDPNTEFQPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQ
FT                   VLLSQCHRYRALVLLGRFLDMGPWAVDLALSVGIYPCVVKLLQTTTIELRQILVFIWTK
FT                   ILALDKSCQVDLVKDRGHIYFIRFLDSSDAFPEQRAMAAFILAVIVDGYKRGQESCLEA
FT                   NLIAVCLGHLEATQLCDPPPEPLFLQWLCLCLGKLWEDYLEAQIMGREANASEKLIPLL
FT                   SEAQPEVRAAAVFALGTLLDVGFDSGKGVCDEEFDDDENIVEDIIIKSLLDVVSDGSPL
FT                   VRTEVAVALARFAFGHKQHLKSVADSYWKPQNSLRTSLPSMAKFHDSGTSIVASSDMGS
FT                   LTRASPDSQPVAREGRISSSLQEPFSGLMQGSPLADDSSLHSDVGIIHDGVSNGVVHQP
FT                   RPLDNAIYSQSVLAMFTLAKDPSPRIASLGRRVLSVIGIEQIVAKPSKSNGRPGEAASA
FT                   SHTPLAGLVRSSSWFDMHTGHLPLTFRTPPVSPPQTSYLTGLRRVCSLELRPHLLGSPD
FT                   SGLADPILGVSGSERSLLPQSTIYNWSCGHFSKPLLGGADANEEIAAQREEKKKFSLEH
FT                   IAKCQHSSISGLSNIPIANWDTKFETGTKTALLHPFSPIVVAADENERIRVWNYEEATL
FT                   LNGFDNNDFPDKGISNLCLVNELDDSLLLVASCDGSVRIWKDYATKGRQKLVTGFSSIQ
FT                   GQKPGASGLNAVVDWQQQSGYLYVSGESLSIMVWDLDKEQLVKSMPFESGCSVTALSAS
FT                   QVHGSQLAAGFADGSVRLYDVRTPDFLVCATRPHQRVEKVVGLSFQPGLDPAKIVSASQ
FT                   AGDIQFLDLRRPKETYLTIDAHRGSLTALGVHRHAPIIASGSAKQLIKVFSLKGEQLGI
FT                   IKYHTSFMGQQIGPVSCLAFHPYQMLLAAGAAGSFVSLYTHHNTQLPR"
     atggcattag gggacttgat ggtctccagg ctctctcaat cttccgttac tgttgtcacc        60
     aatcacctct acgacgacga cgacaactgc gcctcctccg ctcacgatga ttcccgtgtg       120
     tccatcatcg cctctcccag agtcgcaagt agcagctatg agaacctctc cgccgccaca       180
     agcatggcat acttgcctca gactcttgtg ctctgtgacc ttagacacga cgacgcatcc       240
     gacatcgtcc aacccccaag atggcgcctt aaagagcgaa tgaaaacagg atgtgttgct       300
     ctagttatgt gtttgcacat tactgttgat ccccctgatg ttattaagat ttctccctgc       360
     gcaagactcg aatgctggat agatcctttt tctatgtttc ccccaagaag agctcttgag       420
     gctattggcc aaaacttgag cattcagtac gagagatggc tggctcgggc tcgatataaa       480
     gtcgaattgg atcctacaaa ggacgatgtc aggaagctct gcttgtcttg ccggaaatat       540
     gcaaagactg agagagtttt gtttcactat aacgggcatg gtgtccctaa acctacacct       600
     aatggtgaaa tctgggttta caataagaat tttacgcagt acattccctt gccagtcagc       660
     gagcttgatt cctggttgaa aacacccacc atttacgttt ttgactgctc tgctgctagg       720
     gtgatcctca atgccttcgc cgagcttcac gagggggaat cttctggacc cccgaaggac       780
     tgtattctac tggctgcttg tgatgtacat gagacacttc ctcagagtgt tgaatttcca       840
     gctgacgttt ttacttcttg cctcacaaca cctattaata tcgcattgaa atggttctgc       900
     agacgttctc ttctgaaaga atttatagat gaatcactta ttgatagaat tcccggtcgc       960
     caaaatgacc gtaaaacatt gttaggagag ttgaactgga tcttcactgc agtcacagac      1020
     accattgcct ggaatgtgct tccacgcgaa cttttccaga gattattcag acaggacttg      1080
     ttggttgcta gccttttccg aaatttctta ctagctgaga ggataatgcg gtccggaaat      1140
     tgtaccccaa tatcacatcc tatgctacct cctacgcatc agcatcatat gtgggatgca      1200
     tgggacatgg ctgctgaaat ctgcctttct cagcttcctc aattttttct ggacccaaat      1260
     acggagtttc agccaagttc atttttcact gagcaactga cagcttttga ggtctggctg      1320
     gatcatggat ctgagcataa gaagccacca gagcagttac ctattgttct tcaggtctta      1380
     cttagccagt gccatcggta tcgtgctctg gtgcttcttg gaagatttct tgatatgggt      1440
     ccttgggctg tcgatttggc cttatctgtt ggaatatatc cttgcgtagt gaagctgctg      1500
     caaacaacaa ctattgagct acggcagatt cttgttttca tatggacaaa gatcctagca      1560
     cttgataagt cctgtcaagt tgatcttgtg aaggaccggg gccacatata tttcattcga      1620
     tttttagata gttctgatgc attcccagaa caacgtgcta tggctgcgtt tattttggct      1680
     gttattgtcg atggctacaa acgaggccaa gaatcatgtc ttgaagctaa tttaattgct      1740
     gtttgtctgg ggcacctcga agcaacccaa ctatgtgatc caccgccaga accattgttt      1800
     ctacaatggc tttgtctttg tcttggaaag ttgtgggagg actatttgga ggcccagata      1860
     atgggtaggg aggcaaatgc ttctgagaag ttgatacctc tgctttccga ggcccaacca      1920
     gaggtcaggg ctgctgctgt ttttgccttg ggtaccttac ttgatgttgg gtttgactct      1980
     ggtaaaggtg tttgtgatga agaatttgat gatgatgaaa atatagttga agatattatc      2040
     ataaaaagtc tcttagatgt agtttcagat gggagcccgc ttgtccgaac agaggttgct      2100
     gtagctctcg cacggtttgc ttttggacac aaacaacatc taaagtcagt tgcagattca      2160
     tactggaagc cccaaaattc tctgcgaact tctctccctt caatggccaa gtttcatgac      2220
     tctgggactt caatagttgc ttcttcagac atgggttctc tgactagagc tagccctgat      2280
     agccaaccag tggctcgtga aggaaggatc tcaagcagcc tccaagaacc tttttccggg      2340
     ctaatgcaag gatctccatt agctgatgac tcctccttgc attctgatgt tggaatcatc      2400
     catgatggtg tcagcaatgg agttgtccat cagccaagac cgctggataa tgctatctat      2460
     tcgcagagtg ttctagctat gtttacctta gctaaagatc catctccacg tattgcaagc      2520
     cttgggcggc gtgtgctttc tgttattggg attgaacaaa ttgttgcgaa accctccaag      2580
     tccaatggcc gaccaggtga agcagcatca gcatctcaca ctcctctggc tggcctagtt      2640
     cgctcatcct cttggtttga catgcataca ggccacctac cgttaacatt taggactcct      2700
     ccggtaagcc ctccgcaaac aagctattta actggactga ggagagtttg ttcgctagag      2760
     ctccgacctc atctgctggg ttctcccgac tctggattgg ctgatccgat tttaggtgta      2820
     agcgggtctg aacggagttt gcttccacaa tcaactatct acaactggag ctgtggtcac      2880
     ttttccaaac ctcttcttgg cggagcagat gctaatgaag agatagcagc ccaaagagaa      2940
     gaaaaaaaaa agttttcgct ggagcatatt gcaaaatgcc agcattcatc aataagcggg      3000
     ctcagcaata ttccgattgc taattgggat acaaagtttg aaacgggaac aaagacggcc      3060
     ctccttcacc ctttttctcc tattgtagtt gctgccgatg agaatgaacg gattagggtg      3120
     tggaattacg aggaagcaac tcttcttaat ggctttgaca ataacgattt tcctgacaaa      3180
     ggaatttcaa atctctgcct tgtcaatgaa cttgatgact ctctgctact tgttgcctct      3240
     tgcgatggat cagtccgtat atggaaagac tacgcaacaa agggtagaca aaaacttgtc      3300
     acagggtttt cgtcaatcca aggtcagaag cctggtgcaa gtggcctgaa cgctgtcgtg      3360
     gactggcaac aacagtcagg ttacctgtat gtttctgggg aatcgttatc aatcatggtt      3420
     tgggacctgg ataaagaaca gctcgtcaaa tctatgccct ttgaatccgg gtgcagcgtc      3480
     acagcccttt cggcttctca agtgcatggg agtcaacttg ctgctggttt tgcggatgga      3540
     tctgtaagac tctacgacgt tcgcacacct gactttcttg tgtgcgccac tcggcctcat      3600
     cagcgagtag aaaaagtagt tggactcagc tttcagcctg gactcgatcc agcaaagatt      3660
     gtgagcgcat cacaagcagg tgacattcag tttctggatc tgagaagacc aaaggagaca      3720
     tacctgacta tagacgcgca tagaggatca ctgacagcat tgggtgttca tagacatgct      3780
     ccaatcatag cgagcgggtc agcaaaacag ctaataaaag tgttcagcct taaaggagag      3840
     caacttggga tcataaagta ccacacttcc ttcatgggcc aacagattgg cccagtcagt      3900
     tgcctcgcct ttcaccctta ccagatgttg ttagccgcag gggctgctgg ctccttcgtc      3960
     tccttataca cccaccacaa cacacaatta ccaagatag                             3999
//

If you have problems or comments...

PBIL Back to PBIL home page