(data stored in ACNUC13479 zone)

EMBL: CP002688.PE153

CP002688.PE153       Location/Qualifiers
FT   CDS_pept        complement(join(302365..302640,302729..303067,
FT                   303141..303560,304001..304129))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /note="2-oxoglutarate-dependent dioxygenase family protein;
FT                   FUNCTIONS IN: oxidoreductase activity; LOCATED IN:
FT                   cellular_component unknown; EXPRESSED IN: 21 plant
FT                   structures; EXPRESSED DURING: 11 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Oxoglutarate/iron-dependent oxygenase
FT                   (InterPro:IPR005123); BEST Arabidopsis thaliana protein
FT                   match is: 2-oxoglutarate-dependent dioxygenase family
FT                   protein (TAIR:AT3G14160.1); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01780"
FT                   /db_xref="GOA:F4KAV1"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAV1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL213056.1,INSD:ES075606.1,INSD:BP636128.1,
FT                   INSD:EL180229.1,INSD:ES066752.1,INSD:ES079460.1,
FT                   INSD:ES103227.1,INSD:AU036569.1,INSD:ES133826.1,
FT                   INSD:ES048503.1,INSD:EG498571.1,INSD:ES060807.1,
FT                   INSD:EG498572.1,INSD:BP624617.1,INSD:EL258554.1"
FT                   /inference="similar to RNA sequence, mRNA:INSD:BX830679.1"
FT                   /protein_id="AED90390.1"
FT                   /translation="MLNSIHRSFHLTSRHQIVLRLCSPSASRTIMSSSPHSPIPKTHRN
FT                   LGCKNRRRRRASRFLHEESNGTTFEVGAGIGSPTSMVHFDSTNPSSSSKSSQSQNLKIR
FT                   KVRNHRNSGFKSRDQSPQRIKDPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNK
FT                   HKVIRPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNW
FT                   DPQTKYRKNTDIDSKAPEIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDIC
FT                   IVNFYSETGRLGLHQDRDESEESIARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILES
FT                   GDVLIFGGESRMIFHGVKSIIPNSAPMSLLNESKLRTGRLNLTFRHF"
     atgttgaact ctatccatcg ctcgtttcat cttacttccc gccaccagat cgtccttcgg        60
     ctgtgctctc cgtcggcgag taggacgata atgagttctt ctcctcactc tccgatccca       120
     aagacgcata ggaatttggg atgtaagaat aggaggagga gacgggcttc acggttttta       180
     catgaagaat ccaatgggac aacttttgag gttggcgctg gtattggctc tccaacaagt       240
     atggttcatt ttgattctac caacccttct tcttctagta aaagttcaca atctcaaaat       300
     ttgaaaatcc gcaaggttag gaatcacagg aattctggat tcaagagtag ggatcaaagt       360
     cctcagagga taaaggatcc tccgcctttc gacatatgtt cttcagtcct cgaaagaaat       420
     gatacaagta taaaagattg gattttggcg gatgaaacaa acagagaaac tgttgaagtt       480
     agtaataaac acaaagttat aaggcctgga atggtgcttc ttaaagactt ccttacgcct       540
     gatatacagg ttgacattgt gaaaacatgc cgagaacttg gtgttaagcc cacaggattt       600
     taccaaccgg ggtatagtgt tggttcaaag cttcatctgc aaatgatgtg ccttgggcga       660
     aactgggatc ctcagactaa atacaggaaa aacactgaca ttgatagtaa agcaccagag       720
     atccctgtca catttaatgt cttggtagaa aaggcgatcc gagaggcaca tgctctcata       780
     gatagagaat caggaacaga agatgcggag aggatacttc cagtgatgtc accagacatt       840
     tgcatagtca atttctactc agaaactgga agacttggtc tccatcagga ccgtgacgaa       900
     agcgaagaga gtatagcaag agggttgccg atagtgtcct tctccatagg tgattctgca       960
     gagttcttgt acggagagaa gagagacgta gaagaagctc aaggagtgat attagaatca      1020
     ggagatgtgt taatattcgg gggagaatcg cgaatgatct tccatggcgt caagtcaatc      1080
     ataccaaact cagctcccat gtctctactc aacgagtcca agctccgaac aggacgtctc      1140
     aatcttactt ttaggcattt ctaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page