(data stored in ACNUC13479 zone)

EMBL: CP002688.PE154

CP002688.PE154       Location/Qualifiers
FT   CDS_pept        complement(join(302365..302640,302729..303067,
FT                   303141..303725,304001..304129))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /note="2-oxoglutarate-dependent dioxygenase family protein;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN: 21
FT                   plant structures; EXPRESSED DURING: 11 growth stages; BEST
FT                   Arabidopsis thaliana protein match is:
FT                   2-oxoglutarate-dependent dioxygenase family protein
FT                   (TAIR:AT3G14160.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01780"
FT                   /db_xref="GOA:F4KAV2"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAV2"
FT                   /protein_id="AED90391.1"
FT                   /translation="MLNSIHRSFHLTSRHQIVLRLCSPSASRTIMSSSPHSPIPKTHTA
FT                   SLDSLNDYEEQFPPLTGGSKTKKFYLGSTNPSTPCQSSQLQNWTSGKDALSLQRNLGCK
FT                   NRRRRRASRFLHEESNGTTFEVGAGIGSPTSMVHFDSTNPSSSSKSSQSQNLKIRKVRN
FT                   HRNSGFKSRDQSPQRIKDPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNKHKVI
FT                   RPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNWDPQT
FT                   KYRKNTDIDSKAPEIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNF
FT                   YSETGRLGLHQDRDESEESIARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILESGDVL
FT                   IFGGESRMIFHGVKSIIPNSAPMSLLNESKLRTGRLNLTFRHF"
     atgttgaact ctatccatcg ctcgtttcat cttacttccc gccaccagat cgtccttcgg        60
     ctgtgctctc cgtcggcgag taggacgata atgagttctt ctcctcactc tccgatccca       120
     aagacgcata ctgcatcgct tgactcactt aatgattatg aagagcaatt tccaccactt       180
     actggtggct ctaagacgaa gaagttttat cttggttcta ccaatccttc tactccatgt       240
     caaagttcac agcttcaaaa ctggacaagc ggtaaggatg ctttgtcttt gcagaggaat       300
     ttgggatgta agaataggag gaggagacgg gcttcacggt ttttacatga agaatccaat       360
     gggacaactt ttgaggttgg cgctggtatt ggctctccaa caagtatggt tcattttgat       420
     tctaccaacc cttcttcttc tagtaaaagt tcacaatctc aaaatttgaa aatccgcaag       480
     gttaggaatc acaggaattc tggattcaag agtagggatc aaagtcctca gaggataaag       540
     gatcctccgc ctttcgacat atgttcttca gtcctcgaaa gaaatgatac aagtataaaa       600
     gattggattt tggcggatga aacaaacaga gaaactgttg aagttagtaa taaacacaaa       660
     gttataaggc ctggaatggt gcttcttaaa gacttcctta cgcctgatat acaggttgac       720
     attgtgaaaa catgccgaga acttggtgtt aagcccacag gattttacca accggggtat       780
     agtgttggtt caaagcttca tctgcaaatg atgtgccttg ggcgaaactg ggatcctcag       840
     actaaataca ggaaaaacac tgacattgat agtaaagcac cagagatccc tgtcacattt       900
     aatgtcttgg tagaaaaggc gatccgagag gcacatgctc tcatagatag agaatcagga       960
     acagaagatg cggagaggat acttccagtg atgtcaccag acatttgcat agtcaatttc      1020
     tactcagaaa ctggaagact tggtctccat caggaccgtg acgaaagcga agagagtata      1080
     gcaagagggt tgccgatagt gtccttctcc ataggtgatt ctgcagagtt cttgtacgga      1140
     gagaagagag acgtagaaga agctcaagga gtgatattag aatcaggaga tgtgttaata      1200
     ttcgggggag aatcgcgaat gatcttccat ggcgtcaagt caatcatacc aaactcagct      1260
     cccatgtctc tactcaacga gtccaagctc cgaacaggac gtctcaatct tacttttagg      1320
     catttctaa                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page