(data stored in ACNUC13479 zone)

EMBL: CP002688.PE155

CP002688.PE155       Location/Qualifiers
FT   CDS_pept        complement(join(302365..302640,302729..303067,
FT                   303141..303449))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /db_xref="GOA:A0A1P8BHF5"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BHF5"
FT                   /protein_id="ANM71029.1"
FT                   /translation="MVHFDSTNPSSSSKSSQSQNLKIRKVRNHRNSGFKSRDQSPQRIK
FT                   DPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNKHKVIRPGMVLLKDFLTPDIQV
FT                   DIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNWDPQTKYRKNTDIDSKAPEIPV
FT                   TFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNFYSETGRLGLHQDRDESE
FT                   ESIARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILESGDVLIFGGESRMIFHGVKSII
FT                   PNSAPMSLLNESKLRTGRLNLTFRHF"
     atggttcatt ttgattctac caacccttct tcttctagta aaagttcaca atctcaaaat        60
     ttgaaaatcc gcaaggttag gaatcacagg aattctggat tcaagagtag ggatcaaagt       120
     cctcagagga taaaggatcc tccgcctttc gacatatgtt cttcagtcct cgaaagaaat       180
     gatacaagta taaaagattg gattttggcg gatgaaacaa acagagaaac tgttgaagtt       240
     agtaataaac acaaagttat aaggcctgga atggtgcttc ttaaagactt ccttacgcct       300
     gatatacagg ttgacattgt gaaaacatgc cgagaacttg gtgttaagcc cacaggattt       360
     taccaaccgg ggtatagtgt tggttcaaag cttcatctgc aaatgatgtg ccttgggcga       420
     aactgggatc ctcagactaa atacaggaaa aacactgaca ttgatagtaa agcaccagag       480
     atccctgtca catttaatgt cttggtagaa aaggcgatcc gagaggcaca tgctctcata       540
     gatagagaat caggaacaga agatgcggag aggatacttc cagtgatgtc accagacatt       600
     tgcatagtca atttctactc agaaactgga agacttggtc tccatcagga ccgtgacgaa       660
     agcgaagaga gtatagcaag agggttgccg atagtgtcct tctccatagg tgattctgca       720
     gagttcttgt acggagagaa gagagacgta gaagaagctc aaggagtgat attagaatca       780
     ggagatgtgt taatattcgg gggagaatcg cgaatgatct tccatggcgt caagtcaatc       840
     ataccaaact cagctcccat gtctctactc aacgagtcca agctccgaac aggacgtctc       900
     aatcttactt ttaggcattt ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page