(data stored in ACNUC13479 zone)

EMBL: CP002688.PE157

CP002688.PE157       Location/Qualifiers
FT   CDS_pept        complement(join(302684..303067,303141..303725,
FT                   304001..304129))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.50"
FT                   /gene_synonym="T20L15_50"
FT                   /locus_tag="AT5G01780"
FT                   /product="2-oxoglutarate-dependent dioxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01780"
FT                   /db_xref="GOA:A0A1P8BHF6"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BHF6"
FT                   /protein_id="ANM71031.1"
FT                   /translation="MLNSIHRSFHLTSRHQIVLRLCSPSASRTIMSSSPHSPIPKTHTA
FT                   SLDSLNDYEEQFPPLTGGSKTKKFYLGSTNPSTPCQSSQLQNWTSGKDALSLQRNLGCK
FT                   NRRRRRASRFLHEESNGTTFEVGAGIGSPTSMVHFDSTNPSSSSKSSQSQNLKIRKVRN
FT                   HRNSGFKSRDQSPQRIKDPPPFDICSSVLERNDTSIKDWILADETNRETVEVSNKHKVI
FT                   RPGMVLLKDFLTPDIQVDIVKTCRELGVKPTGFYQPGYSVGSKLHLQMMCLGRNWDPQT
FT                   KYRKNTDIDSKAPEIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNF
FT                   YSETGRLGLHQVLCSLTLNLFEGFS"
     atgttgaact ctatccatcg ctcgtttcat cttacttccc gccaccagat cgtccttcgg        60
     ctgtgctctc cgtcggcgag taggacgata atgagttctt ctcctcactc tccgatccca       120
     aagacgcata ctgcatcgct tgactcactt aatgattatg aagagcaatt tccaccactt       180
     actggtggct ctaagacgaa gaagttttat cttggttcta ccaatccttc tactccatgt       240
     caaagttcac agcttcaaaa ctggacaagc ggtaaggatg ctttgtcttt gcagaggaat       300
     ttgggatgta agaataggag gaggagacgg gcttcacggt ttttacatga agaatccaat       360
     gggacaactt ttgaggttgg cgctggtatt ggctctccaa caagtatggt tcattttgat       420
     tctaccaacc cttcttcttc tagtaaaagt tcacaatctc aaaatttgaa aatccgcaag       480
     gttaggaatc acaggaattc tggattcaag agtagggatc aaagtcctca gaggataaag       540
     gatcctccgc ctttcgacat atgttcttca gtcctcgaaa gaaatgatac aagtataaaa       600
     gattggattt tggcggatga aacaaacaga gaaactgttg aagttagtaa taaacacaaa       660
     gttataaggc ctggaatggt gcttcttaaa gacttcctta cgcctgatat acaggttgac       720
     attgtgaaaa catgccgaga acttggtgtt aagcccacag gattttacca accggggtat       780
     agtgttggtt caaagcttca tctgcaaatg atgtgccttg ggcgaaactg ggatcctcag       840
     actaaataca ggaaaaacac tgacattgat agtaaagcac cagagatccc tgtcacattt       900
     aatgtcttgg tagaaaaggc gatccgagag gcacatgctc tcatagatag agaatcagga       960
     acagaagatg cggagaggat acttccagtg atgtcaccag acatttgcat agtcaatttc      1020
     tactcagaaa ctggaagact tggtctccat caggtgttgt gcagtttgac tttaaacctc      1080
     tttgaagggt tctcttga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page