(data stored in ACNUC13479 zone)

EMBL: CP002688.PE158

CP002688.PE158       Location/Qualifiers
FT   CDS_pept        complement(305057..305683)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.60"
FT                   /gene_synonym="T20L15_60"
FT                   /locus_tag="AT5G01790"
FT                   /product="hypothetical protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast; EXPRESSED IN: 19 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; Has 121 Blast hits to
FT                   121 proteins in 12 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 0; Fungi - 0; Plants - 121; Viruses - 0; Other
FT                   Eukaryotes - 0 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01790"
FT                   /db_xref="GOA:Q6NNJ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NNJ2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG516967.1,INSD:ES052854.1,INSD:ES087009.1,
FT                   INSD:ES152420.1,INSD:AV556068.1,INSD:DR382885.1,
FT                   INSD:DR358030.1,INSD:ES165735.1,INSD:EL969275.1,
FT                   INSD:ES046949.1,INSD:ES151941.1,INSD:AV567657.1,
FT                   INSD:T03962.1,INSD:EG516966.1,INSD:EL986476.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT010833.1,INSD:BX833131.1,INSD:BX833182.1,
FT                   INSD:BT011294.1,INSD:BT015487.1,INSD:BX833276.1,
FT                   INSD:BX833153.1"
FT                   /protein_id="AED90392.1"
FT                   /translation="MHTSLPLFPSLSLSHSPKTIMPNAGSERAASLSLKKQDTATFSGK
FT                   LPSTKQRFSSVSAACPSFRIYYYDGAAGAVPFEWESHPGTPKHPSSELPTLPPLTPPPS
FT                   HFSFSGDQIRRRSKKSTKKILALIPTRLFWLSGDHNGKAKKLSASSPPSLSERVLIDEN
FT                   EYDLFKFQTERNVMRRFSSFDSSADYPIQRSQSTSCFGIRRCFLC"
     atgcacacat ctctccctct ctttccttcc ctctctctct ctcactctcc caagacaata        60
     atgccaaacg cgggatctga gcgggcagct tcactctcac tgaaaaagca agacaccgcc       120
     accttctccg gtaagctacc gtcgaccaaa caacgttttt cgtcggtatc agctgcttgt       180
     ccttccttta gaatctacta ctacgacgga gccgccggtg ccgtcccttt cgaatgggaa       240
     tctcatccag gcacacccaa acacccctcc tctgagctac ctactctgcc acctctcact       300
     cctccgccgt ctcatttctc tttctccggc gaccaaatcc gccgccgttc caaaaagtcc       360
     accaagaaaa tcctcgcact aatcccgaca aggctcttct ggctatcggg cgatcacaat       420
     ggtaaggcta agaaactgtc ggcttcatca ccaccatctc tgtcggagag agtgttgatc       480
     gacgaaaatg agtacgatct gttcaagttt caaacagaaa ggaatgtcat gcgaagattt       540
     tcatccttcg actcttctgc tgactaccca attcagagat cacaatccac ttcctgcttc       600
     ggaatccgca gatgtttcct ctgctaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page