(data stored in ACNUC13479 zone)

EMBL: CP002688.PE159

CP002688.PE159       Location/Qualifiers
FT   CDS_pept        join(307422..307509,307732..307880,307976..308176,
FT                   308316..308375,308491..308646)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.70"
FT                   /gene_synonym="T20L15_70"
FT                   /locus_tag="AT5G01800"
FT                   /product="saposin B domain-containing protein"
FT                   /note="saposin B domain-containing protein; FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: N-terminal protein
FT                   myristoylation, lipid metabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 23 plant structures;
FT                   EXPRESSED DURING: 15 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Saposin B (InterPro:IPR008139), Saposin-like
FT                   (InterPro:IPR011001), Saposin-like type B, 1
FT                   (InterPro:IPR007856), Saposin-like type B, 2
FT                   (InterPro:IPR008138); BEST Arabidopsis thaliana protein
FT                   match is: saposin B domain-containing protein
FT                   (TAIR:AT3G51730.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW6"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZW6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV786281.1,INSD:ES155587.1,INSD:CF651301.1,
FT                   INSD:BP820469.2,INSD:DR373625.1,INSD:ES156334.1,
FT                   INSD:CA782013.1,INSD:EL155867.1,INSD:BP623188.1,
FT                   INSD:EH913951.1,INSD:BP810596.1,INSD:ES123589.1,
FT                   INSD:EL095419.1,INSD:ES095499.1,INSD:BP605571.1,
FT                   INSD:DR251561.1,INSD:T46286.1,INSD:EH882448.1,
FT                   INSD:ES082269.1,INSD:EL156870.1,INSD:EL280246.1,
FT                   INSD:ES139225.1,INSD:AV536823.1,INSD:CB261910.1,
FT                   INSD:ES078455.1,INSD:EL330829.1,INSD:EH824011.1,
FT                   INSD:AV539745.1,INSD:EL252815.1,INSD:EH798239.1,
FT                   INSD:EL076095.1,INSD:EL310237.1,INSD:EL332483.1,
FT                   INSD:EL037097.1,INSD:EH934565.1,INSD:Z17475.1,
FT                   INSD:EL285752.1,INSD:ES212048.1,INSD:CF651302.1,
FT                   INSD:EH819068.1,INSD:EL208794.1,INSD:BP615397.1,
FT                   INSD:EL983588.1,INSD:ES100109.1,INSD:EH977072.1,
FT                   INSD:BP851133.2,INSD:EL975354.1,INSD:ES190736.1,
FT                   INSD:EH967478.1,INSD:EL095637.1,INSD:EH814423.1,
FT                   INSD:EL189751.1,INSD:AA720259.1,INSD:ES166906.1,
FT                   INSD:EH885076.1,INSD:EH862378.1,INSD:DR251562.1,
FT                   INSD:EL327821.1,INSD:EH848374.1,INSD:EL050696.1,
FT                   INSD:EH889506.1,INSD:EL206675.1,INSD:T43403.1,
FT                   INSD:EL254135.1,INSD:ES175802.1,INSD:EL056448.1,
FT                   INSD:EH803510.1,INSD:EL021464.1,INSD:ES182599.1,
FT                   INSD:EL969371.1,INSD:ES085984.1,INSD:EG495642.1,
FT                   INSD:BP588159.1,INSD:EL065598.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX834065.1,INSD:AY056420.1,INSD:BX830665.1,
FT                   INSD:AY081711.1,INSD:BX833129.1"
FT                   /protein_id="AED90393.1"
FT                   /translation="MGGRFGVLLVLFLLSWSCHATNPILLEPFESAHDDNQVCELCDKY
FT                   VTLVIDYLQDYDNQNELVEALHISCSQIPPLKKQCLSMVDHYTQLFFTQVSTIKSDQIC
FT                   KRLNLCQAVTPAFASQVHQGNCEACRETVSEVVTKLKDPETKLKIIRLLLKECKSLNNY
FT                   QDKCKKMVFEYGPLMLTDLQKFLEKKDVCTILHVCPGPATHRDYVPAVESLADS"
     atgggcggta gatttggagt cctcctagtc ctcttcctct tgagctggtc ttgtcatgct        60
     acaaacccga ttcttctcga accattcgaa tcagctcatg atgacaacca agtctgtgaa       120
     ctatgtgaca agtatgtcac gctagtcatt gattaccttc aagactacga caaccagaat       180
     gaactcgttg aggcccttca tatcagctgc tctcagattc ctcctctcaa aaaacagtgt       240
     ctttcaatgg tagatcatta cacccaactt ttcttcacac aagtctctac tatcaaatca       300
     gaccaaatct gcaaacggct taacctctgt caagctgtga caccggcctt tgcctctcaa       360
     gtccatcaag gaaactgcga ggcttgccgc gagactgtct ctgaggttgt caccaaactc       420
     aaggatcctg agactaagct gaagataatt cggttacttc tcaaggaatg caagtcgctt       480
     aacaattacc aggacaagtg caagaagatg gtattcgagt acgggcctct gatgcttacg       540
     gatttgcaga agtttctgga gaagaaagac gtgtgcacta tcctccacgt ctgtccaggt       600
     ccagccaccc accgtgacta cgttcctgcg gtggagtcat tggcagattc gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page