(data stored in ACNUC13479 zone)

EMBL: CP002688.PE16

CP002688.PE16        Location/Qualifiers
FT   CDS_pept        join(22740..23054,23136..23271,23359..23492,23580..23771,
FT                   23858..24130)
FT                   /codon_start=1
FT                   /gene="BSK10"
FT                   /gene_synonym="brassinosteroid-signaling kinase 10"
FT                   /gene_synonym="F7J8.40"
FT                   /gene_synonym="F7J8_40"
FT                   /locus_tag="AT5G01060"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01060"
FT                   /db_xref="GOA:A0A1P8BE32"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE32"
FT                   /protein_id="ANM69869.1"
FT                   /translation="MGCICFKSWRRSSSSPSITSTVIDDLENVREYDADDDGGHYPLIF
FT                   REFSLEQLRIATDGFSAGNIVSEHNDSVPNIVYKGKLGDGRRIAVKRFQRLSWPDPFEF
FT                   INEAQAVGRLRSEHMANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSVRVTLSI
FT                   YSRIKNSLS"
     atgggatgca tttgcttcaa gtcttggcgc cgatcatctt cttcaccgtc gattacgtca        60
     acggtcatag atgatctcga aaacgtcaga gagtacgatg ccgacgacga cggaggacat       120
     tatccgttga ttttccgtga gttcagttta gaacagctga gaatcgccac cgacggtttc       180
     tccgccggaa acatcgtatc ggagcacaac gattcggtac caaacatcgt ctacaaagga       240
     aaactcggcg atggtcgtcg catcgccgtc aaacggtttc aaagactttc ttggcctgat       300
     cctttcgaat tcatcaatga agcacaagct gttgggagat tgaggagtga acatatggcg       360
     aatttgatcg gttgttgttg tgatgacaac gagagattac ttgttgctga gtatatgcct       420
     aatggaacat tagcaaaaca tctttttcac tgggagaaaa gacccatgaa atgggaaatg       480
     aggttgaaag ttgctctgca tactgcaaga gctttggagt attgtaatga taaaggaatt       540
     gatttatacc atgatcttaa tccttacagg attatgtttg ataagacagg gattcctaag       600
     ctttcttgct ttggtctcat gaagaatagc catgaaggga agatttatag caccaactta       660
     gcttttgctc ctcccgagta tttgcgcctt ggtactgtga tagcggagag cgtcacattt       720
     agctttggaa ccttgttatt ggatcttatg agcggcagac atattcctcc aaaccatgca       780
     cttgatttgt tccgtggcaa aaactatttg gtgctaatgg attcagctct tgatggtcag       840
     ttctctgatg aagacaggac agaactaata cacgtagctt ctcgatgttt caagactgaa       900
     ccagaagaga ggccaagtat aaagtttctt aaggcgactc tttctagact tcagaaacgg       960
     gccaagttgt gccctattaa tgtcaaaaga cctatgtctg tacgtgtcac tctctccata      1020
     tattcaagaa tcaagaatag tctctcttga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page