(data stored in ACNUC13479 zone)

EMBL: CP002688.PE162

CP002688.PE162       Location/Qualifiers
FT   CDS_pept        join(310460..311308,311444..311725)
FT                   /codon_start=1
FT                   /gene="CIPK15"
FT                   /gene_synonym="ATPK10"
FT                   /gene_synonym="CBL-interacting protein kinase 15"
FT                   /gene_synonym="PKS3"
FT                   /gene_synonym="PROTEIN KINASE 10"
FT                   /gene_synonym="SERINE/THREONINE PROTEIN KINASE 10"
FT                   /gene_synonym="SIP2"
FT                   /gene_synonym="SMALL AND BASIC INTRINSIC PROTEIN 2"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.1"
FT                   /gene_synonym="SNRK3.1"
FT                   /gene_synonym="SOS3-INTERACTING PROTEIN 2"
FT                   /gene_synonym="T20L15.80"
FT                   /gene_synonym="T20L15_80"
FT                   /locus_tag="AT5G01810"
FT                   /product="CBL-interacting protein kinase 15"
FT                   /note="CBL-interacting protein kinase 15 (CIPK15); CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase-like domain
FT                   (InterPro:IPR011009), NAF domain (InterPro:IPR004041),
FT                   CBL-interacting protein kinase (InterPro:IPR020660),
FT                   Protein kinase, catalytic domain (InterPro:IPR000719),
FT                   Tyrosine-protein kinase, catalytic domain
FT                   (InterPro:IPR020635), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: CBL-interacting protein kinase 20
FT                   (TAIR:AT5G45820.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01810"
FT                   /db_xref="GOA:F4KAV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAV7"
FT                   /protein_id="AED90396.1"
FT                   /translation="MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDK
FT                   ERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTG
FT                   KLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRR
FT                   QDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYK
FT                   KIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEE
FT                   TEEEMRFTSNREASEITEKLVEIGKDLKMKVRKKEHEWRVKMSAEATVVEAEVFEIAPS
FT                   YHMVVLKKSGGDTAEYKRVMKESIRPALIDFVLAWH"
     atggagaaga aaggatctgt gttgatgctc cgttatgagg ttgggaagtt tctcggtcaa        60
     ggtacctttg ctaaggtata ccatgctagg catttgaaaa ctggtgatag tgtagcgatt       120
     aaggtcatcg acaaagaaag aatcctcaaa gttggcatga ccgagcagat taagcgagag       180
     atctctgcca tgagactctt gaggcatccc aacatcgttg agctccatga agtcatggcc       240
     accaaatcta aaatctactt cgtcatggaa catgttaagg gtggtgagct cttcaacaaa       300
     gtgtcaactg ggaagctgag agaagacgtt gcgagaaagt actttcagca gcttgtacgc       360
     gctgttgact tctgtcacag ccgtggagta tgccacaggg acctgaagcc ggagaatctc       420
     ttgttggatg agcatgggaa tcttaagatc tctgattttg gtctcagcgc tctttctgac       480
     tctagaaggc aagacgggtt gctgcatact acatgcggga cccctgcata tgttgcaccg       540
     gaggtgataa gcaggaacgg gtatgatggg tttaaagcgg atgtgtggtc ctgtggagtg       600
     atattgttcg tcttgctcgc tggatatctt cctttccgtg attccaatct gatggagctg       660
     tataagaaga taggcaaagc tgaagtcaag ttccccaact ggcttgctcc gggggcaaag       720
     agattgctca agaggatctt ggatcctaac cccaacacaa gggtatcaac tgagaaaata       780
     atgaagagct cttggttccg taaaggccta caagaggagg tgaaagaatc agttgaggaa       840
     gagacagaag aggagatgag gtttacatca aacagagagg catctgagat aacagagaag       900
     ctggtggaga ttgggaagga ccttaagatg aaagtgagga agaaggaaca cgaatggagg       960
     gtgaaaatgt cggctgaggc tacagtggtg gaagcggaag tgtttgagat tgcgccgagc      1020
     tatcacatgg tggtgctaaa gaagagcggt ggagatactg ctgagtataa gagagtcatg      1080
     aaggagagta taagaccggc tttgatcgac tttgtattag cttggcactg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page