(data stored in ACNUC13479 zone)

EMBL: CP002688.PE166

CP002688.PE166       Location/Qualifiers
FT   CDS_pept        join(332829..333336,333420..333544,333639..333797,
FT                   333899..334180)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.120"
FT                   /gene_synonym="T20L15_120"
FT                   /locus_tag="AT5G01850"
FT                   /product="Protein kinase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01850"
FT                   /db_xref="GOA:A0A1P8BGL4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BGL4"
FT                   /protein_id="ANM70739.1"
FT                   /translation="MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIK
FT                   VVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKVSLLLSSLSLLSILLLEYTISIWQ
FT                   FIGACKDPLMVIVTELLPGMSLRKYLTSIRPQLLHLPLALSFALDIARALHCLHANGII
FT                   HRDLKPDNLLLTENHKSVKLADFGLAREESVTEMMTAETGTYRWMAPELYSTVTLRQGE
FT                   KKHYNNKVDVYSFGIVLWELLTNRMPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFI
FT                   VQSCWVEDPNMRPSFSQIIRLLNEFLLTLTPPPPQPLPETATNRTNGRAITEFSIRPKG
FT                   KFAFIRQLFAAKRNINS"
     atgagtagcg atgatacgat tgaggagagt ttgcttgtgg atcccaaatt gttgttcatc        60
     ggctccaaga ttggtgaagg cgctcacggc aaagtctacc aaggaaggta tggtcgtcag       120
     attgttgcaa tcaaagttgt caaccggggc tccaaacctg accagcaatc ttctctcgag       180
     agccgtttcg tccgtgaggt caatatgatg tcccgcgttc aacaccataa ccttgtcaag       240
     gtctctctcc ttctttcttc tctttctttg ctctcgatac ttcttcttga atacacaata       300
     tccatttggc agtttattgg agcgtgcaaa gatcctttaa tggtaatagt aacagagctt       360
     ctcccaggga tgtctctccg taaatatctc accagcatcc gtcctcagtt gctccatctc       420
     cctcttgctc tctcctttgc ccttgacatc gcccgtgcct tgcactgctt acacgccaat       480
     ggtatcattc acagagacct caaacctgac aacttattgc tcacggagaa tcacaaatcc       540
     gtcaagcttg ctgatttcgg gcttgctagg gaagaatccg tgactgagat gatgactgct       600
     gagactggga cttaccgttg gatggctcct gagctctaca gtacagtgac cctgcgtcaa       660
     ggagagaaga agcattacaa caacaaagtt gatgtctaca gctttggaat cgtgctttgg       720
     gagcttctca ctaatcgtat gccattcgag ggcatgtcca atctgcaagc cgcctacgca       780
     gcagcattca agcaggagag gcccgtaatg ccagagggga tatctccgag tctggcgttc       840
     atagtgcagt cttgttgggt ggaggaccca aacatgaggc caagcttcag tcaaattatc       900
     agactgctca atgagttcct ccttaccctg actcctccgc ctcctcagcc tctgcctgag       960
     actgccacca acaggaccaa tggccgagcc atcactgagt tctccatccg tccaaaaggg      1020
     aaatttgcct tcattcgcca gcttttcgct gccaagagga acataaactc ttag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page