(data stored in ACNUC13479 zone)

EMBL: CP002688.PE167

CP002688.PE167       Location/Qualifiers
FT   CDS_pept        join(332829..333068,333141..333336,333420..333544,
FT                   333639..333797,333899..334180)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.120"
FT                   /gene_synonym="T20L15_120"
FT                   /locus_tag="AT5G01850"
FT                   /product="Protein kinase superfamily protein"
FT                   /note="Protein kinase superfamily protein; FUNCTIONS IN:
FT                   protein serine/threonine/tyrosine kinase activity, kinase
FT                   activity; INVOLVED IN: protein amino acid phosphorylation;
FT                   EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Protein kinase,
FT                   ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Serine-threonine/tyrosine-protein
FT                   kinase (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Serine/threonine-protein
FT                   kinase, ATN1-like (InterPro:IPR015784); BEST Arabidopsis
FT                   thaliana protein match is: Protein kinase superfamily
FT                   protein (TAIR:AT3G27560.1); Has 131148 Blast hits to 129643
FT                   proteins in 5072 species: Archae - 162; Bacteria - 15033;
FT                   Metazoa - 49603; Fungi - 12189; Plants - 33321; Viruses -
FT                   522; Other Eukaryotes - 20318 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01850"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01850.1"
FT                   /db_xref="GOA:Q8L6Y9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L6Y9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES215389.1,INSD:EL186897.1,INSD:AV560070.1,
FT                   INSD:ES001505.1,INSD:AV533466.1,INSD:EH981384.1,
FT                   INSD:EL083070.1,INSD:EL990112.1,INSD:AV830310.1,
FT                   INSD:EL974629.1,INSD:AV811144.1,INSD:AV440394.1,
FT                   INSD:ES079158.1,INSD:EL001430.1,INSD:ES066339.1,
FT                   INSD:BP866957.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT002168.1,INSD:AY140072.1,INSD:BX830646.1"
FT                   /protein_id="AED90401.1"
FT                   /translation="MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIK
FT                   VVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKFIGACKDPLMVIVTELLPGMSLRK
FT                   YLTSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFG
FT                   LAREESVTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNR
FT                   MPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNE
FT                   FLLTLTPPPPQPLPETATNRTNGRAITEFSIRPKGKFAFIRQLFAAKRNINS"
     atgagtagcg atgatacgat tgaggagagt ttgcttgtgg atcccaaatt gttgttcatc        60
     ggctccaaga ttggtgaagg cgctcacggc aaagtctacc aaggaaggta tggtcgtcag       120
     attgttgcaa tcaaagttgt caaccggggc tccaaacctg accagcaatc ttctctcgag       180
     agccgtttcg tccgtgaggt caatatgatg tcccgcgttc aacaccataa ccttgtcaag       240
     tttattggag cgtgcaaaga tcctttaatg gtaatagtaa cagagcttct cccagggatg       300
     tctctccgta aatatctcac cagcatccgt cctcagttgc tccatctccc tcttgctctc       360
     tcctttgccc ttgacatcgc ccgtgccttg cactgcttac acgccaatgg tatcattcac       420
     agagacctca aacctgacaa cttattgctc acggagaatc acaaatccgt caagcttgct       480
     gatttcgggc ttgctaggga agaatccgtg actgagatga tgactgctga gactgggact       540
     taccgttgga tggctcctga gctctacagt acagtgaccc tgcgtcaagg agagaagaag       600
     cattacaaca acaaagttga tgtctacagc tttggaatcg tgctttggga gcttctcact       660
     aatcgtatgc cattcgaggg catgtccaat ctgcaagccg cctacgcagc agcattcaag       720
     caggagaggc ccgtaatgcc agaggggata tctccgagtc tggcgttcat agtgcagtct       780
     tgttgggtgg aggacccaaa catgaggcca agcttcagtc aaattatcag actgctcaat       840
     gagttcctcc ttaccctgac tcctccgcct cctcagcctc tgcctgagac tgccaccaac       900
     aggaccaatg gccgagccat cactgagttc tccatccgtc caaaagggaa atttgccttc       960
     attcgccagc ttttcgctgc caagaggaac ataaactctt ag                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page