(data stored in ACNUC13479 zone)

EMBL: CP002688.PE168

CP002688.PE168       Location/Qualifiers
FT   CDS_pept        335630..336277
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.130"
FT                   /gene_synonym="T20L15_130"
FT                   /locus_tag="AT5G01860"
FT                   /product="C2H2 and C2HC zinc fingers superfamily protein"
FT                   /note="C2H2 and C2HC zinc fingers superfamily protein;
FT                   FUNCTIONS IN: sequence-specific DNA binding transcription
FT                   factor activity, zinc ion binding, nucleic acid binding;
FT                   INVOLVED IN: regulation of transcription; LOCATED IN:
FT                   intracellular, chloroplast; EXPRESSED IN: shoot, sepal,
FT                   root, leaf; EXPRESSED DURING: LP.02 two leaves visible,
FT                   petal differentiation and expansion stage; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, C2H2-like
FT                   (InterPro:IPR015880), Zinc finger, C2H2-type
FT                   (InterPro:IPR007087); BEST Arabidopsis thaliana protein
FT                   match is: C2H2 and C2HC zinc fingers superfamily protein
FT                   (TAIR:AT5G27880.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZW0"
FT                   /protein_id="AED90402.1"
FT                   /translation="MELNLSTPTSCSSSSISSSSHEAIPRTKGKTKEEVTAEPSKENQQ
FT                   RLEFRFLFNESSTRNEAKARVFACTFCKKEFSTSQALGGHQNAHKQERSLAKRRKEIEI
FT                   NYPELSIYSQYPPSGLSFSSSSSQYDLGVRYNPNIAKTTKPYPFNIFACRFGYRGGLNF
FT                   PPMSHLSVPKTDDLSINLISNLEGSIHDQAVKKDQPEADPCKDSDIDLSLKL"
     atggaactaa acctctctac acccacatca tgttcctcca gcagcatctc atcatcttcg        60
     catgaggcca tccctaggac caagggtaaa acgaaagagg aggtcacggc tgagccgtcg       120
     aaggagaatc agcagcggct agagttccgc ttcctgttca acgagagtag tacaagaaac       180
     gaggctaaag cgagggtgtt tgcttgcacc ttctgcaaaa aagagttctc tacgtctcaa       240
     gccttaggag gacatcagaa cgctcacaag caagagcgat cattggctaa aaggcgtaaa       300
     gagatcgaaa tcaactatcc tgaactctcc atctacagcc agtacccgcc aagtggactt       360
     tccttcagca gcagctcctc gcagtatgat ctcggggttc gttacaatcc taacattgct       420
     aaaactacta agccctatcc gttcaacatc ttcgcatgtc gatttggata cagaggggga       480
     ctaaatttcc ctcccatgtc tcacctctcg gttccaaaga cagacgattt gtccataaac       540
     ttgatttcaa atctagaggg cagcattcac gaccaagccg taaaaaaaga tcaacctgaa       600
     gctgatcctt gcaaggattc tgatatagac ttgtccctta agctatag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page