(data stored in ACNUC13479 zone)

EMBL: CP002688.PE169

CP002688.PE169       Location/Qualifiers
FT   CDS_pept        join(337234..337574,337669..337678)
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.140"
FT                   /gene_synonym="T20L15_140"
FT                   /locus_tag="AT5G01870"
FT                   /product="Bifunctional inhibitor/lipid-transfer
FT                   protein/seed storage 2S albumin superfamily protein"
FT                   /note="Bifunctional inhibitor/lipid-transfer protein/seed
FT                   storage 2S albumin superfamily protein; FUNCTIONS IN: lipid
FT                   binding; INVOLVED IN: lipid transport; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 15 plant structures;
FT                   EXPRESSED DURING: 7 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Bifunctional inhibitor/plant lipid transfer
FT                   protein/seed storage (InterPro:IPR016140), Plant lipid
FT                   transfer protein/seed storage/trypsin-alpha amylase
FT                   inhibitor (InterPro:IPR003612), Plant lipid transfer
FT                   protein/Par allergen (InterPro:IPR000528), Plant lipid
FT                   transfer protein/hydrophobic protein, helical domain
FT                   (InterPro:IPR013770); BEST Arabidopsis thaliana protein
FT                   match is: lipid transfer protein 6 (TAIR:AT3G08770.1); Has
FT                   1807 Blast hits to 1807 proteins in 277 species: Archae -
FT                   0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV9"
FT                   /db_xref="InterPro:IPR000528"
FT                   /db_xref="InterPro:IPR016140"
FT                   /db_xref="InterPro:IPR036312"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV9"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP587064.1,INSD:AI998609.1,INSD:BP593031.1,
FT                   INSD:AA597869.1,INSD:BP857534.1,INSD:EL976573.1,
FT                   INSD:BP625831.1,INSD:CB253232.1,INSD:AU235904.1,
FT                   INSD:AA650642.1,INSD:EL034220.1,INSD:BP635731.1,
FT                   INSD:BP595196.1,INSD:BP576943.1,INSD:ES174257.1,
FT                   INSD:BP565153.1,INSD:BP636339.1,INSD:ES145400.1,
FT                   INSD:ES050770.1,INSD:ES073859.1,INSD:BP584949.1,
FT                   INSD:EG466378.1,INSD:ES079750.1,INSD:BP575437.1,
FT                   INSD:BP865464.1,INSD:BP623814.1,INSD:AU226677.1,
FT                   INSD:BP636021.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227988.1,INSD:BX833231.1,INSD:BX832243.1"
FT                   /protein_id="AED90403.1"
FT                   /translation="MMRVVLPLCLLLASIFAWGSEAAISCNAVQANLYPCVVYVVQGGA
FT                   IPYSCCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPY
FT                   KIDPSTNCNSIK"
     atgatgagag ttgtgttacc actatgcctg cttcttgctt ccatatttgc atggggttct        60
     gaagcagcca tatcttgcaa cgccgtacag gccaaccttt acccgtgcgt tgtgtacgtg       120
     gtgcagggag gagccattcc gtatagctgt tgcaatggca tcaggatgct cagcaaacag       180
     gcaactagcg catcagacaa acaaggtgtg tgtcgctgca tcaagtctgt ggtgggaaga       240
     gtgtcttact cgtcaatcta tctcaagaaa gctgctgctt tgccaggcaa gtgcggtgtc       300
     aaacttcctt acaagatcga cccttccacc aactgcaaca gcattaagtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page