(data stored in ACNUC13479 zone)

EMBL: CP002688.PE17

CP002688.PE17        Location/Qualifiers
FT   CDS_pept        join(23175..23271,23359..23492,23580..23771,23858..24079,
FT                   24181..24336,24412..24525,24617..24847)
FT                   /codon_start=1
FT                   /gene="BSK10"
FT                   /gene_synonym="brassinosteroid-signaling kinase 10"
FT                   /gene_synonym="F7J8.40"
FT                   /gene_synonym="F7J8_40"
FT                   /locus_tag="AT5G01060"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01060"
FT                   /db_xref="GOA:A0A1P8BE40"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BE40"
FT                   /protein_id="ANM69868.1"
FT                   /translation="MANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSPPSKNLP
FT                   EKTKPATESLKLTPFGDACSRADLSSIHELLEKLGYEEDNGVGNEFSFQMWTGEMQENM
FT                   DYKKHGDAAFLAKDFDTAIEFYTEFMTGAPTVSPTVLARRCLCYLMTEMFSEALSDAMQ
FT                   AQVASPEWPIPLYLQAACLFKLEMEAEAKEALRHGSALEAY"
     atggcgaatt tgatcggttg ttgttgtgat gacaacgaga gattacttgt tgctgagtat        60
     atgcctaatg gaacattagc aaaacatctt tttcactggg agaaaagacc catgaaatgg       120
     gaaatgaggt tgaaagttgc tctgcatact gcaagagctt tggagtattg taatgataaa       180
     ggaattgatt tataccatga tcttaatcct tacaggatta tgtttgataa gacagggatt       240
     cctaagcttt cttgctttgg tctcatgaag aatagccatg aagggaagat ttatagcacc       300
     aacttagctt ttgctcctcc cgagtatttg cgccttggta ctgtgatagc ggagagcgtc       360
     acatttagct ttggaacctt gttattggat cttatgagcg gcagacatat tcctccaaac       420
     catgcacttg atttgttccg tggcaaaaac tatttggtgc taatggattc agctcttgat       480
     ggtcagttct ctgatgaaga caggacagaa ctaatacacg tagcttctcg atgtttcaag       540
     actgaaccag aagagaggcc aagtataaag tttcttaagg cgactctttc tagacttcag       600
     aaacgggcca agttgtgccc tattaatgtc aaaagaccta tgtctcctcc atcaaaaaat       660
     ctgcctgaaa agactaaacc tgcaacagag tcattgaagt tgactccttt cggagatgca       720
     tgttctagag cggatctaag tagtatacat gaactactag agaaactagg gtatgaagaa       780
     gataatgggg ttggtaacga gttttcattc caaatgtgga ccggcgaaat gcaagagaat       840
     atggactaca agaagcatgg agatgccgcg tttcttgcga aagattttga tactgccatt       900
     gaattctaca cagagttcat gactggagct cctacggtat caccaacagt attggcaaga       960
     aggtgtcttt gttacctaat gactgaaatg ttcagcgagg ctctaagcga tgcgatgcaa      1020
     gcgcaagtag cttcaccgga atggccaatt cctctttact tacaagcggc ttgtctcttc      1080
     aagctagaga tggaagctga agctaaagaa gcacttagac atggttctgc tcttgaggct      1140
     tattag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page