(data stored in ACNUC13479 zone)

EMBL: CP002688.PE170

CP002688.PE170       Location/Qualifiers
FT   CDS_pept        339017..339496
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.150"
FT                   /gene_synonym="T20L15_150"
FT                   /gene_synonym="DAF-Like gene 2"
FT                   /gene_synonym="DAFL2"
FT                   /locus_tag="AT5G01880"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; EXPRESSED IN: 10 plant structures; EXPRESSED
FT                   DURING: LP.04 four leaves visible, 4 anthesis, C globular
FT                   stage, petal differentiation and expansion stage; CONTAINS
FT                   InterPro DOMAIN/s: Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
FT                   (InterPro:IPR018957); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G10910.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZV8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH928766.1,INSD:EG479466.1,INSD:EG479459.1,
FT                   INSD:EG479471.1,INSD:EG419709.1,INSD:Z34026.1,
FT                   INSD:EG479456.1,INSD:EG478682.1,INSD:EG478698.1,
FT                   INSD:EG479462.1,INSD:EG479465.1,INSD:EG479457.1,
FT                   INSD:EG479461.1,INSD:EH917560.1,INSD:EG478683.1,
FT                   INSD:EL158103.1,INSD:EG479455.1,INSD:BP655144.1,
FT                   INSD:EG479472.1,INSD:EH960988.1,INSD:EG478696.1,
FT                   INSD:EG478680.1,INSD:EG478694.1,INSD:EG479458.1,
FT                   INSD:EG478699.1,INSD:CB258748.1,INSD:BP641836.1,
FT                   INSD:EG479470.1,INSD:EG478689.1,INSD:EG479474.1,
FT                   INSD:EG478681.1,INSD:EG478687.1,INSD:EG479467.1,
FT                   INSD:ES093711.1,INSD:EG479469.1,INSD:BP612083.1,
FT                   INSD:EG478692.1,INSD:AU228792.1,INSD:EG478677.1,
FT                   INSD:EG478690.1,INSD:EG479468.1,INSD:EG478691.1,
FT                   INSD:EG479463.1,INSD:BP660370.1,INSD:EG478695.1,
FT                   INSD:EG478684.1,INSD:BP655253.1,INSD:AU237707.1,
FT                   INSD:EG478685.1,INSD:EL251213.1,INSD:BP833856.1,
FT                   INSD:EL249069.1,INSD:EG479454.1,INSD:EG478688.1,
FT                   INSD:ES137740.1,INSD:EL072657.1,INSD:EG478676.1,
FT                   INSD:BP623598.1,INSD:EG479460.1,INSD:BP629875.1,
FT                   INSD:EG479473.1,INSD:EG479476.1,INSD:BP651369.1,
FT                   INSD:EG478693.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK229217.1,INSD:BX830343.1,INSD:BX833914.1,
FT                   INSD:BX833639.1,INSD:BT010973.1,INSD:EF182905.1,
FT                   INSD:BT010682.1"
FT                   /protein_id="AED90404.1"
FT                   /translation="MHRLLLESHGGGNETSGSGGGDGYTRDMNFDANMVIILAALLCAL
FT                   ILALGLNSILRCAMRCGFGLSSSAAAGTVADRAGLKKRELKKFPVAEYGSGEVKIAATE
FT                   CAICLGEFADGERVRVLPPCNHSFHMSCIDTWLVSHSSCPNCRHSLIEVHVAGSE"
     atgcatcgac tgctactgga atcccacggc ggcgggaacg agacgagcgg aagcggcggg        60
     ggagatgggt acacgaggga catgaacttc gacgcaaaca tggtgatcat acttgcggct       120
     cttctctgcg cgctgatact agcgcttggg ctgaattcga ttctccggtg cgcgatgcga       180
     tgcggtttcg ggttatcatc ctctgcggcg gcggggacgg tggccgacag agctggatta       240
     aagaagagag aactgaagaa gtttccagta gctgagtacg ggtcggggga agtgaagata       300
     gcggcgacgg agtgcgcaat ctgtctgggg gaattcgcgg acggcgagag agtgcgagta       360
     ctgccgccgt gtaatcacag tttccacatg tcatgcatcg acacgtggct tgtctctcac       420
     tcttcatgtc ccaattgtcg gcattcactc atcgaggtcc acgtggcggg gtctgagtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page