(data stored in ACNUC13479 zone)

EMBL: CP002688.PE171

CP002688.PE171       Location/Qualifiers
FT   CDS_pept        339838..340266
FT                   /codon_start=1
FT                   /locus_tag="AT5G01881"
FT                   /product="transmembrane protein"
FT                   /note="unknown protein; Has 3 Blast hits to 3 proteins in 2
FT                   species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0;
FT                   Plants - 3; Viruses - 0; Other Eukaryotes - 0 (source: NCBI
FT                   BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01881.1"
FT                   /db_xref="GOA:Q2V3A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q2V3A8"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG479467.1,INSD:EG478687.1,INSD:EH928766.1,
FT                   INSD:EG479469.1,INSD:EG479466.1,INSD:EG478692.1,
FT                   INSD:EG479459.1,INSD:EG479471.1,INSD:EG478677.1,
FT                   INSD:EG419709.1,INSD:EG478690.1,INSD:EG479468.1,
FT                   INSD:EG479456.1,INSD:EG478682.1,INSD:EG479463.1,
FT                   INSD:EG478691.1,INSD:EG478695.1,INSD:EG478684.1,
FT                   INSD:EG478685.1,INSD:EG479465.1,INSD:EG479462.1,
FT                   INSD:EG478698.1,INSD:EG479454.1,INSD:EG479457.1,
FT                   INSD:EG478688.1,INSD:EG479461.1,INSD:EG478683.1,
FT                   INSD:EL158103.1,INSD:EG479455.1,INSD:EG479472.1,
FT                   INSD:EH960988.1,INSD:EG478696.1,INSD:EL072657.1,
FT                   INSD:EG478680.1,INSD:EG478694.1,INSD:EG478676.1,
FT                   INSD:EG479458.1,INSD:EG478699.1,INSD:EG479460.1,
FT                   INSD:EG479470.1,INSD:EG479473.1,INSD:EG479476.1,
FT                   INSD:EG479474.1,INSD:EG478689.1,INSD:EG478693.1,
FT                   INSD:EG478681.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:EF182905.1,INSD:BX830343.1"
FT                   /protein_id="AED90405.1"
FT                   /translation="MSEEEEEEQRRRLGVGVVWKLKVCVRAKGFSLKLNIRNKLSLHRW
FT                   SILLRFRKHHHHLKSKPSDWVRFRRSLFALFRGRKQREVDTKKKLIKLVRNRAVVVAKK
FT                   AKGVGVVVTLIIVVINFLVPWINKLSSELDCYELFGIK"
     atgagtgaag aagaagaaga agagcagagg aggaggttgg gagtgggggt ggtgtggaag        60
     cttaaagtat gtgtgagagc caaaggtttc agtttgaagc tcaatatacg gaacaagctc       120
     tcgcttcatc gatggtcaat cctcttaaga ttccgaaagc atcatcatca tctcaaatcc       180
     aaaccgtccg attgggtcag attccgacgg agtctttttg ctctcttccg tggacgaaaa       240
     cagagggaag tggatacgaa gaagaaactc atcaaattgg ttaggaatcg agcggtggta       300
     gtggcaaaga aagcaaaagg cgttggtgtt gtggttactc tcatcatcgt cgtcatcaat       360
     tttctagtcc catggatcaa caagctgagc agcgaattag attgttatga attgtttggt       420
     attaaataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page