(data stored in ACNUC13479 zone)

EMBL: CP002688.PE172

CP002688.PE172       Location/Qualifiers
FT   CDS_pept        complement(join(341661..343107,343194..344650))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.160"
FT                   /gene_synonym="T20L15_160"
FT                   /gene_synonym="PXC2"
FT                   /gene_synonym="PXY/TDR-correlated 2"
FT                   /locus_tag="AT5G01890"
FT                   /product="Leucine-rich receptor-like protein kinase family
FT                   protein"
FT                   /note="Leucine-rich receptor-like protein kinase family
FT                   protein; FUNCTIONS IN: protein serine/threonine kinase
FT                   activity, kinase activity, ATP binding; INVOLVED IN:
FT                   transmembrane receptor protein tyrosine kinase signaling
FT                   pathway, protein amino acid phosphorylation; LOCATED IN:
FT                   plasma membrane; EXPRESSED IN: 22 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Leucine-rich repeat-containing
FT                   N-terminal domain, type 2 (InterPro:IPR013210),
FT                   Leucine-rich repeat (InterPro:IPR001611),
FT                   Serine-threonine/tyrosine-protein kinase
FT                   (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: Leucine-rich repeat protein kinase family protein
FT                   (TAIR:AT3G56370.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01890"
FT                   /db_xref="GOA:Q9LZV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV7"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP591269.1,INSD:DR362258.1,INSD:AV545971.1,
FT                   INSD:AV546670.1,INSD:EH833919.1,INSD:AV550395.1,
FT                   INSD:BP603095.1,INSD:EL019187.1,INSD:EL256797.1,
FT                   INSD:BP798200.1,INSD:EL226709.1,INSD:EL172632.1,
FT                   INSD:EL031685.1,INSD:BP598389.1,INSD:AV530444.1,
FT                   INSD:AV553714.1,INSD:EG519415.1,INSD:BP606476.1,
FT                   INSD:AV532756.1,INSD:AV824587.1,INSD:EL031903.1,
FT                   INSD:BP601690.1,INSD:EH897067.1,INSD:DR362259.1,
FT                   INSD:AV554791.1,INSD:AV546291.1,INSD:AV522783.1,
FT                   INSD:EG519416.1,INSD:AV548793.1,INSD:AV786807.1,
FT                   INSD:EL106101.1,INSD:BP609202.1,INSD:AV548219.1,
FT                   INSD:EG422692.1,INSD:BP612496.1,INSD:AV547112.1,
FT                   INSD:AV545809.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF424563.1,INSD:BT004520.1"
FT                   /protein_id="AED90406.1"
FT                   /translation="MFNGAVSLLFLFLAVVSARADPTFNDDVLGLIVFKAGLDDPLSKL
FT                   SSWNSEDYDPCNWVGCTCDPATNRVSELRLDAFSLSGHIGRGLLRLQFLHTLVLSNNNL
FT                   TGTLNPEFPHLGSLQVVDFSGNNLSGRIPDGFFEQCGSLRSVSLANNKLTGSIPVSLSY
FT                   CSTLTHLNLSSNQLSGRLPRDIWFLKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSR
FT                   NWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNSLIGEIPDWI
FT                   GDIATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLISIDV
FT                   SKNSFTGDVLKWMFTGNSESSSLSRFSLHKRSGNDTIMPIVGFLQGLRVLDLSSNGFTG
FT                   ELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTLPSEIGGAVS
FT                   LKQLHLHRNRLSGQIPAKISNCSALNTINLSENELSGAIPGSIGSLSNLEYIDLSRNNL
FT                   SGSLPKEIEKLSHLLTFNISHNNITGELPAGGFFNTIPLSAVTGNPSLCGSVVNRSCLS
FT                   VHPKPIVLNPNSSNPTNGPALTGQIRKSVLSISALIAIGAAAVIAIGVVAVTLLNVHAR
FT                   SSVSRHDAAAALALSVGETFSCSPSKDQEFGKLVMFSGEVDVFDTTGADALLNKDSELG
FT                   RGGFGVVYKTSLQDGRPVAVKKLTVSGLIKSQEEFEREMRKLGKLRHKNVVEIKGYYWT
FT                   QSLQLLIHEFVSGGSLYRHLHGDESVCLTWRQRFSIILGIARGLAFLHSSNITHYNMKA
FT                   TNVLIDAAGEAKVSDFGLARLLASALDRCVLSGKVQSALGYTAPEFACRTVKITDRCDV
FT                   YGFGILVLEVVTGKRPVEYAEDDVVVLCETVREGLEEGRVEECVDPRLRGNFPAEEAIP
FT                   VIKLGLVCGSQVPSNRPEMEEVVKILELIQCPSHDLE"
     atgttcaacg gcgccgtttc actactcttc ctcttccttg ccgtcgtttc agcgagggca        60
     gatccgacat tcaacgacga cgttttgggt ctcatcgttt tcaaggccgg actcgacgac       120
     cctctctcta agctctcttc ttggaactcg gaagactacg atccctgcaa ctgggtcggt       180
     tgcacatgcg accctgccac caatcgggtc tcggagctcc gccttgacgc cttctctctc       240
     tccggtcaca tcggccgtgg ccttctccgt ctccagttcc tccacacctt ggtcctctcc       300
     aacaacaacc tcaccggaac cctaaacccc gagttccctc acctcggcag cctccaagtc       360
     gtcgatttca gtggcaataa tctctcgggt cggatcccag acgggttctt cgagcaatgc       420
     gggtccttga ggtccgtttc cttggctaac aacaaactca caggttctat tcctgtctcc       480
     ctcagctact gttctactct cacccatctt aacctctcaa gcaatcaact ctctgggagg       540
     ttgccccgag atatctggtt cctcaagagc ttaaagtccc ttgatttctc tcacaatttc       600
     ctccaaggag atatccccga tggcctcggc ggtctctacg atctccgtca tatcaactta       660
     tccaggaact ggttttccgg tgacgttcct tccgacatcg gacgatgctc ttcccttaaa       720
     tcgcttgact tgagtgagaa ctacttctcc gggaatcttc cggattcgat gaaaagcctg       780
     ggctcttgca gctccatccg tctgcgagga aactctctga tcggagaaat ccctgattgg       840
     atcggcgaca ttgccactct cgagattctt gatctctccg ccaacaactt caccggcact       900
     gtcccattct ccctcggaaa tctcgagttt ttgaaggatc tcaatctatc cgcaaacatg       960
     ctcgctggag agctcccaca gactctctcc aactgctcca acctaatctc cattgatgtc      1020
     agcaagaatt cattcaccgg agatgtgctt aagtggatgt tcaccggaaa ctctgaaagt      1080
     tcctcgcttt ccagatttag cctccacaaa agatcaggga acgacaccat tatgcccatc      1140
     gttggattcc tccaaggtct ccgggtcctc gatctgtctt caaacggctt caccggtgaa      1200
     ttaccgtcta acatttggat tctcacaagt ttgttgcagc tcaatatgtc caccaactct      1260
     ctcttcggtt ccatacccac cggcattgga ggattgaaag tcgctgagat tcttgatctt      1320
     agtagtaatc ttctcaacgg aacccttcct tctgagatcg gaggagccgt ctccctgaaa      1380
     caacttcatc tccacagaaa ccgcctctcc ggccagattc cggcaaagat ctctaactgt      1440
     tcggctttaa acacaataaa tctatcggag aatgaactat ccggtgcgat tccggggagc      1500
     attggcagtc tgagcaacct tgagtacatt gatctgtcga gaaacaatct ctcgggaagt      1560
     cttcccaaag aaatagagaa actttcgcat ctcttgacct ttaacatctc ccacaacaac      1620
     atcacagggg agctgccagc tggaggtttc ttcaacacca tccctctctc tgctgtcacc      1680
     ggaaacccat ccctttgtgg ctccgtcgtt aaccgctcat gtctctctgt ccaccccaaa      1740
     ccaatcgtcc tcaaccccaa ctcctccaat ccaacaaatg gtcctgctct cacagggcag      1800
     atcaggaaga gcgttctgag catatctgcg ctcattgcca ttggcgcagc tgccgtcatt      1860
     gccatcgggg tggtggctgt aactctgctc aacgtgcacg cccgatctag tgtttcacgt      1920
     cacgatgcag ctgctgctct cgctctgtcg gttggagaga cgttcagctg ttcgccaagt      1980
     aaagatcaag agtttggaaa gctggtcatg ttctcagggg aagtggacgt gtttgacacc      2040
     actggcgctg atgcgttgct caacaaggac agcgagctgg gacgaggcgg gttcggtgtg      2100
     gtgtacaaaa cgagtcttca ggatgggcgt cctgtggcag ttaagaaact gacagtgtcg      2160
     ggtctaataa agtcgcagga ggagttcgag agagagatga gaaaactcgg gaagctgagg      2220
     cacaagaatg tggtggagat aaaagggtac tactggacgc aatcgctgca gctcttgatc      2280
     cacgagtttg tttcaggcgg aagcttgtac agacatctcc acggagatga gagcgtttgc      2340
     ctaacttggc gtcaacgttt cagtatcatt ctagggatag caagaggtct ggcttttctg      2400
     catagcagta acatcactca ctacaacatg aaagcaacga atgtgctcat tgacgccgca      2460
     ggggaggcta aagtctctga ctttgggctg gccagactgt tggcttcggc gctggacagg      2520
     tgcgtcttga gtggcaaggt acagagcgcg ttggggtaca cagccccgga gtttgcatgc      2580
     cggacagtca agataaccga caggtgcgat gtttacgggt ttgggatcct ggtgctggag      2640
     gtggtgacag ggaagagacc cgtggagtac gctgaggacg acgtcgtggt cttgtgtgag      2700
     acggtgagag aagggttaga agaagggagg gtggaggagt gcgttgaccc tcggttgaga      2760
     gggaattttc cagcggagga ggcaataccg gtgattaaac tagggttggt gtgtgggtcc      2820
     caagtgccgt cgaataggcc ggagatggag gaagtggtga agatattaga gctcatacaa      2880
     tgtccctctc atgacttaga gtga                                             2904
//

If you have problems or comments...

PBIL Back to PBIL home page