(data stored in ACNUC13479 zone)

EMBL: CP002688.PE173

CP002688.PE173       Location/Qualifiers
FT   CDS_pept        343365..343910
FT                   /codon_start=1
FT                   /locus_tag="AT5G01895"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BBA6"
FT                   /protein_id="ANM68878.1"
FT                   /translation="MPVGMEPKRELVDILSCNKLVRIQMLDGNSPVKPFEDRSRTRRPW
FT                   RNPTMGIMVSFPDLLWRLNLESEELSEFPVNIHLSTSPVNEFLLTSMEIRLEQLERVCG
FT                   SSPASMFADRLRSFKNSRFPRENGTVPVKLLAERSRISRVAMSPIQSGISPIREFPRRR
FT                   MELQEPRLFIESGRFPEK"
     atgccggtgg gtatggaacc gaagagagag ttggtggaca tattgagctg caacaaactt        60
     gtgagaatcc aaatgttaga cggtaattca ccggtgaagc cgtttgaaga cagatcgagg       120
     acccggagac cttggaggaa tccaacgatg ggcataatgg tgtcgttccc tgatcttttg       180
     tggaggctaa atctggaaag cgaggaactt tcagagtttc cggtgaacat ccacttaagc       240
     acatctccgg tgaatgaatt cttgctgaca tcaatggaga ttaggttgga gcagttggag       300
     agagtctgtg ggagctctcc agcgagcatg tttgcggata gattgagatc cttcaaaaac       360
     tcgagatttc cgagggagaa tgggacagtg ccggtgaagt tgttggcgga gagatcaaga       420
     atctcgagag tggcaatgtc gccgatccaa tcagggattt ctccgatcag agagtttcct       480
     cgcagacgga tggagctgca agagcccagg cttttcatcg aatccggaag attcccggag       540
     aagtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page