(data stored in ACNUC13479 zone)

EMBL: CP002688.PE175

CP002688.PE175       Location/Qualifiers
FT   CDS_pept        complement(join(357950..358084,358164..358229,
FT                   358314..358655))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.180"
FT                   /gene_synonym="T20L15_180"
FT                   /locus_tag="AT5G01910"
FT                   /product="myelin transcription factor"
FT                   /note="unknown protein; Has 66 Blast hits to 66 proteins in
FT                   27 species: Archae - 0; Bacteria - 2; Metazoa - 18; Fungi -
FT                   7; Plants - 29; Viruses - 0; Other Eukaryotes - 10 (source:
FT                   NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01910"
FT                   /db_xref="GOA:Q1PE06"
FT                   /db_xref="UniProtKB/TrEMBL:Q1PE06"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG525076.1,INSD:EG525064.1,INSD:EG525071.1,
FT                   INSD:EG525077.1,INSD:EG525081.1,INSD:EG525066.1,
FT                   INSD:EG525059.1,INSD:EG525083.1,INSD:EG525080.1,
FT                   INSD:EG525065.1,INSD:EG525079.1,INSD:EG525063.1,
FT                   INSD:EG525060.1,INSD:ES029881.1,INSD:EG421639.1,
FT                   INSD:EL255089.1,INSD:EG525082.1,INSD:EG525069.1,
FT                   INSD:EG421638.1,INSD:ES020167.1,INSD:EG525084.1,
FT                   INSD:EG525073.1,INSD:EG421636.1,INSD:EL170641.1,
FT                   INSD:EG421637.1,INSD:EG525068.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ653260.1,INSD:DQ446912.1"
FT                   /protein_id="AED90408.1"
FT                   /translation="MKCSGRKALQPRNIYQTPKEDAFFVKPKAAEKLKENLNLETSIDA
FT                   SLAEELSAFKKKLERLREDRESTEKLLKERDEAMDLHMSHLLQRGETQKSLEIQVDRLF
FT                   RLKELHAYSSKISPIRSLRAKEQQEKMRRFTFAGEEQPDEESSVEIANGPIEEESSTKS
FT                   NVLERDMIIANTQPIIS"
     atgaaatgtt caggtcgaaa agcactgcag ccgagaaaca tctaccagac cccaaaggag        60
     gatgctttct tcgtgaagcc caaagctgca gagaagctca aggagaatct gaatcttgag       120
     acatcaatcg atgcttctct tgcggaggag cttagtgcct tcaagaagaa actcgagagg       180
     ctgagagagg atcgagagag cactgagaag ctgctaaagg agagagatga agccatggat       240
     ctgcacatga gccatcttct ccagagagga gagacacaga aaagccttga aatccaggtc       300
     gatcgcctct ttcgattgaa ggagctccac gcctattcct ctaagatttc tccaatccga       360
     tctctgagag ccaaggagca gcaggagaag atgagacgct tcaccttcgc aggtgaagaa       420
     caaccagatg aagaaagctc cgtcgagatc gctaatgggc ccattgaaga agaaagctcg       480
     accaaaagta atgtgttgga gagagatatg atcatcgcaa atacccaacc catcatatct       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page