(data stored in ACNUC13479 zone)

EMBL: CP002688.PE176

CP002688.PE176       Location/Qualifiers
FT   CDS_pept        complement(join(358077..358229,358314..358655))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.180"
FT                   /gene_synonym="T20L15_180"
FT                   /locus_tag="AT5G01910"
FT                   /product="myelin transcription factor"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; EXPRESSED
FT                   IN: 16 plant structures; EXPRESSED DURING: 11 growth
FT                   stages; Has 30201 Blast hits to 17322 proteins in 780
FT                   species: Archae - 12; Bacteria - 1396; Metazoa - 17338;
FT                   Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes
FT                   - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01910"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01910.2"
FT                   /db_xref="GOA:B3H7E6"
FT                   /db_xref="UniProtKB/TrEMBL:B3H7E6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG525084.1,INSD:EG525074.1,INSD:EL255089.1,
FT                   INSD:EG525075.1,INSD:ES029881.1,INSD:ES020167.1"
FT                   /protein_id="AED90409.1"
FT                   /translation="MKCSGRKALQPRNIYQTPKEDAFFVKPKAAEKLKENLNLETSIDA
FT                   SLAEELSAFKKKLERLREDRESTEKLLKERDEAMDLHMSHLLQRGETQKSLEIQVDRLF
FT                   RLKELHAYSSKISPIRSLRAKEQQEKMRRFTFVINVSTLLSLSFFLPIHLWVFSRPFSG
FT                   R"
     atgaaatgtt caggtcgaaa agcactgcag ccgagaaaca tctaccagac cccaaaggag        60
     gatgctttct tcgtgaagcc caaagctgca gagaagctca aggagaatct gaatcttgag       120
     acatcaatcg atgcttctct tgcggaggag cttagtgcct tcaagaagaa actcgagagg       180
     ctgagagagg atcgagagag cactgagaag ctgctaaagg agagagatga agccatggat       240
     ctgcacatga gccatcttct ccagagagga gagacacaga aaagccttga aatccaggtc       300
     gatcgcctct ttcgattgaa ggagctccac gcctattcct ctaagatttc tccaatccga       360
     tctctgagag ccaaggagca gcaggagaag atgagacgct tcaccttcgt aataaatgtt       420
     tcaacactac tctccctttc cttctttctt cccattcatt tatgggtttt ttctcgacct       480
     ttttcaggca ggtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page