(data stored in ACNUC13479 zone)

EMBL: CP002688.PE18

CP002688.PE18        Location/Qualifiers
FT   CDS_pept        complement(join(25094..25343,25429..25799))
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.50"
FT                   /gene_synonym="F7J8_50"
FT                   /locus_tag="AT5G01070"
FT                   /product="RING/FYVE/PHD zinc finger superfamily protein"
FT                   /note="RING/FYVE/PHD zinc finger superfamily protein;
FT                   FUNCTIONS IN: zinc ion binding; CONTAINS InterPro DOMAIN/s:
FT                   Zinc finger, C3HC4 RING-type (InterPro:IPR018957), Zinc
FT                   finger, RING-CH-type (InterPro:IPR011016); BEST Arabidopsis
FT                   thaliana protein match is: RING/FYVE/PHD zinc finger
FT                   superfamily protein (TAIR:AT2G37950.1); Has 1807 Blast hits
FT                   to 1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:F4K7X7"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7X7"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT024791.1,INSD:DQ059128.1"
FT                   /protein_id="AED90294.2"
FT                   /translation="MSSYEISHIDLENGSGERQYRPSDVSGEDSSSCDYDYDFHSAVRS
FT                   FCGEFEIADDLDDETDTESVASGSIRGSPEKDCRICHLGLESSRHECGDPMVLGCSCKD
FT                   DLGYVHKQCADTWFKIKGNKTCEICRSIAQNFFKVDNEIGQTTVETNVDDVEAGNTPTM
FT                   VATSDSDDRRLCRGNRFLNFLLTCMVCAFVISWFFHFNLPSHK"
     atgtcatctt acgaaatctc tcacattgat ttagaaaatg gttccggcga gcgtcaatac        60
     cgtccaagtg acgtcagcgg agaagatagt tcttcttgtg attacgacta cgattttcac       120
     tcagctgttc gtagcttttg cggcgagttt gagattgctg atgatttgga cgacgaaaca       180
     gatacagaat cagtagcctc tggatcaatc agagggtctc cggagaaaga ttgccggatt       240
     tgccatttgg gtttagagag tagtcgtcat gaatgtggag atccaatggt tcttggatgt       300
     tcttgtaaag atgatttggg ttatgttcat aagcaatgtg ccgatacttg gttcaagatc       360
     aagggtaata agacttgcga gatttgtcgt tcgatagctc aaaacttttt taaagttgac       420
     aatgagattg gtcaaacaac ggttgaaacc aatgtagatg acgtagaggc cggaaataca       480
     cccacgatgg tggctacaag cgattccgat gatcggagat tatgtagagg aaatagattc       540
     cttaatttcc ttttaacatg tatggtctgt gcatttgtaa tctcatggtt ctttcacttt       600
     aacttgcctt cacacaaatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page