(data stored in ACNUC13479 zone)

EMBL: CP002688.PE180

CP002688.PE180       Location/Qualifiers
FT   CDS_pept        complement(join(363594..363635,363732..363820,
FT                   363913..364055,364135..364277,364357..364418,
FT                   364526..364625,364701..364865))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.210"
FT                   /gene_synonym="T20L15_210"
FT                   /locus_tag="AT5G01940"
FT                   /product="eukaryotic translation initiation factor 2B
FT                   family protein / eIF-2B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01940"
FT                   /db_xref="GOA:A0A1P8BFD8"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BFD8"
FT                   /protein_id="ANM70277.1"
FT                   /translation="MSEGPIQAQSQSLVSFLIFLRSTLKLVDPPATMDLQQKQACWKLE
FT                   LEVIDNDSSWVSKFDPSKKKKKKKQKPLIREDDIFFQNGGHFTEDNLPDCQSSRKFEPD
FT                   YGYKELLSMVFDRLREEDVEVSTERPRTVMMPPQLLAEGTITVCLNFADLCRTMHRKPD
FT                   HVMKFLLAQMETKVSLNKQQRLEIKGLVSSKDFQAVFRKYIDAFVICVCCKSPDTALAE
FT                   EGNGLFNLRCETCGLVAPVDIPNLL"
     atgtctgaag gcccaataca ggcccaatca cagtccctgg tttcgttttt aattttcctc        60
     cgatcaacgc tgaaacttgt cgacccgccg gcgacgatgg atttacagca aaagcaggcg       120
     tgttggaaac ttgaactcga ggttatagat aacgattctt catgggtcag taaatttgat       180
     ccttctaaga agaagaagaa gaagaagcag aagcctctga tacgcgaaga cgacatcttc       240
     ttccagaatg gaggacactt tacggaggat aacttaccgg actgtcaatc tagccggaaa       300
     tttgagccag attatggcta caaagagctc ttgagtatgg tgtttgatag gcttcgtgag       360
     gaagatgtcg aggtttctac agagaggcca agaacagtga tgatgcctcc tcagctcctt       420
     gcagaaggga cgataactgt ttgtttaaac tttgctgatc tctgcagaac gatgcatagg       480
     aagccagatc atgtcatgaa attcttactt gcccaaatgg agacaaaagt atcgctgaac       540
     aaacagcagc ggctagagat taagggttta gtgtcttcta aggattttca agctgtgttc       600
     cggaaataca ttgatgcgtt cgtaatctgc gtctgctgca aaagtcctga cacagctctc       660
     gcggaggagg gcaatggtct tttcaatctc agatgtgaga cgtgtggttt agtagcacca       720
     gtcgatatac caaatctact gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page