(data stored in ACNUC13479 zone)

EMBL: CP002688.PE181

CP002688.PE181       Location/Qualifiers
FT   CDS_pept        complement(join(363594..363635,363732..363820,
FT                   363913..364055,364135..364277,364357..364418,
FT                   364526..364625,364701..364769))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.210"
FT                   /gene_synonym="T20L15_210"
FT                   /locus_tag="AT5G01940"
FT                   /product="eukaryotic translation initiation factor 2B
FT                   family protein / eIF-2B family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01940"
FT                   /db_xref="GOA:A0A178UNV7"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A178UNV7"
FT                   /protein_id="ANM70276.1"
FT                   /translation="MDLQQKQACWKLELEVIDNDSSWVSKFDPSKKKKKKKQKPLIRED
FT                   DIFFQNGGHFTEDNLPDCQSSRKFEPDYGYKELLSMVFDRLREEDVEVSTERPRTVMMP
FT                   PQLLAEGTITVCLNFADLCRTMHRKPDHVMKFLLAQMETKVSLNKQQRLEIKGLVSSKD
FT                   FQAVFRKYIDAFVICVCCKSPDTALAEEGNGLFNLRCETCGLVAPVDIPNLL"
     atggatttac agcaaaagca ggcgtgttgg aaacttgaac tcgaggttat agataacgat        60
     tcttcatggg tcagtaaatt tgatccttct aagaagaaga agaagaagaa gcagaagcct       120
     ctgatacgcg aagacgacat cttcttccag aatggaggac actttacgga ggataactta       180
     ccggactgtc aatctagccg gaaatttgag ccagattatg gctacaaaga gctcttgagt       240
     atggtgtttg ataggcttcg tgaggaagat gtcgaggttt ctacagagag gccaagaaca       300
     gtgatgatgc ctcctcagct ccttgcagaa gggacgataa ctgtttgttt aaactttgct       360
     gatctctgca gaacgatgca taggaagcca gatcatgtca tgaaattctt acttgcccaa       420
     atggagacaa aagtatcgct gaacaaacag cagcggctag agattaaggg tttagtgtct       480
     tctaaggatt ttcaagctgt gttccggaaa tacattgatg cgttcgtaat ctgcgtctgc       540
     tgcaaaagtc ctgacacagc tctcgcggag gagggcaatg gtcttttcaa tctcagatgt       600
     gagacgtgtg gtttagtagc accagtcgat ataccaaatc tactgtga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page