(data stored in ACNUC13479 zone)

EMBL: CP002688.PE182

CP002688.PE182       Location/Qualifiers
FT   CDS_pept        complement(join(363594..363683,363732..363820,
FT                   363913..364055,364135..364277,364357..364418,
FT                   364526..364625,364701..364769))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.210"
FT                   /gene_synonym="T20L15_210"
FT                   /locus_tag="AT5G01940"
FT                   /product="eukaryotic translation initiation factor 2B
FT                   family protein / eIF-2B family protein"
FT                   /note="eukaryotic translation initiation factor 2B family
FT                   protein / eIF-2B family protein; FUNCTIONS IN: translation
FT                   initiation factor activity; INVOLVED IN: translational
FT                   initiation; LOCATED IN: cellular_component unknown;
FT                   EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 12
FT                   growth stages; CONTAINS InterPro DOMAIN/s: Translation
FT                   initiation factor IF2/IF5, N-terminal (InterPro:IPR016189),
FT                   Translation initiation factor IF2/IF5 (InterPro:IPR002735);
FT                   BEST Arabidopsis thaliana protein match is: eukaryotic
FT                   translation initiation factor 2 beta subunit
FT                   (TAIR:AT5G20920.2); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01940"
FT                   /db_xref="GOA:Q9LZV2"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZV2"
FT                   /inference="similar to RNA sequence, EST:INSD:EL192540.1"
FT                   /protein_id="AED90412.1"
FT                   /translation="MDLQQKQACWKLELEVIDNDSSWVSKFDPSKKKKKKKQKPLIRED
FT                   DIFFQNGGHFTEDNLPDCQSSRKFEPDYGYKELLSMVFDRLREEDVEVSTERPRTVMMP
FT                   PQLLAEGTITVCLNFADLCRTMHRKPDHVMKFLLAQMETKVSLNKQQRLEIKGLVSSKD
FT                   FQAVFRKYIDAFVICVCCKSPDTALAEEGNGLFNLRCETGKDEDKLVSFESVLVQCGLV
FT                   APVDIPNLL"
     atggatttac agcaaaagca ggcgtgttgg aaacttgaac tcgaggttat agataacgat        60
     tcttcatggg tcagtaaatt tgatccttct aagaagaaga agaagaagaa gcagaagcct       120
     ctgatacgcg aagacgacat cttcttccag aatggaggac actttacgga ggataactta       180
     ccggactgtc aatctagccg gaaatttgag ccagattatg gctacaaaga gctcttgagt       240
     atggtgtttg ataggcttcg tgaggaagat gtcgaggttt ctacagagag gccaagaaca       300
     gtgatgatgc ctcctcagct ccttgcagaa gggacgataa ctgtttgttt aaactttgct       360
     gatctctgca gaacgatgca taggaagcca gatcatgtca tgaaattctt acttgcccaa       420
     atggagacaa aagtatcgct gaacaaacag cagcggctag agattaaggg tttagtgtct       480
     tctaaggatt ttcaagctgt gttccggaaa tacattgatg cgttcgtaat ctgcgtctgc       540
     tgcaaaagtc ctgacacagc tctcgcggag gagggcaatg gtcttttcaa tctcagatgt       600
     gagacgggga aagatgagga taaattggtc tcatttgagt ctgttcttgt gcagtgtggt       660
     ttagtagcac cagtcgatat accaaatcta ctgtga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page