(data stored in ACNUC13479 zone)

EMBL: CP002688.PE186

CP002688.PE186       Location/Qualifiers
FT   CDS_pept        complement(join(365040..365507,365585..365835,
FT                   365919..365970,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369082,
FT                   369285..369532))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /note="Leucine-rich repeat protein kinase family protein;
FT                   FUNCTIONS IN: protein serine/threonine kinase activity,
FT                   kinase activity, ATP binding; INVOLVED IN: transmembrane
FT                   receptor protein tyrosine kinase signaling pathway, protein
FT                   amino acid phosphorylation; LOCATED IN: chloroplast, plasma
FT                   membrane; EXPRESSED IN: 19 plant structures; EXPRESSED
FT                   DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Protein kinase, ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase domain
FT                   (InterPro:IPR002290), Leucine-rich repeat-containing
FT                   N-terminal domain, type 2 (InterPro:IPR013210),
FT                   Leucine-rich repeat (InterPro:IPR001611),
FT                   Serine/threonine-protein kinase-like domain
FT                   (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Tyrosine-protein kinase,
FT                   catalytic domain (InterPro:IPR020635); BEST Arabidopsis
FT                   thaliana protein match is: Leucine-rich repeat protein
FT                   kinase family protein (TAIR:AT1G06840.1); Has 195622 Blast
FT                   hits to 137374 proteins in 5075 species: Archae - 144;
FT                   Bacteria - 18537; Metazoa - 60927; Fungi - 10261; Plants -
FT                   82888; Viruses - 345; Other Eukaryotes - 22520 (source:
FT                   NCBI BLink)."
FT                   /db_xref="GOA:F4KAX4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:F4KAX4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AA712879.1,INSD:AV523401.1,INSD:BP839115.1,
FT                   INSD:CA782044.1,INSD:EL163808.1,INSD:DR368835.1,
FT                   INSD:AV529062.1,INSD:AI993749.1,INSD:ES037161.1,
FT                   INSD:AV526845.1,INSD:ES143186.1,INSD:DR383549.1,
FT                   INSD:AV547400.1,INSD:AV522986.1,INSD:EL983739.1,
FT                   INSD:AV523939.1,INSD:AU036572.1"
FT                   /protein_id="AED90413.1"
FT                   /translation="MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLD
FT                   PKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHL
FT                   EILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNIT
FT                   GPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALP
FT                   NLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNE
FT                   LTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKN
FT                   ISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKE
FT                   WISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPY
FT                   IDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIR
FT                   GIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAI
FT                   SAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRG
FT                   GYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESE
FT                   QMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKA
FT                   SNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDK
FT                   SDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFA
FT                   ALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNVTRDLY
FT                   ESSSLLGSDLSSGFVPSIAPR"
     atggtgttcc ctcaaagact ctatctacat gcgctccttg ttgcctgttg ttgcgtcctt        60
     ctgcttgccg atgctcaaag aacccaccct tcagaagtca ctgctttacg atctgttaaa       120
     agaagtctac ttgaccctaa agattatttg agaaactgga atagaggcga cccttgcaga       180
     tcaaattgga ctggagttat ctgctttaat gagattggta ctgacgacta cctgcatgtc       240
     cgagaactcc tgctgatgaa tatgaatctc tccgggactt tgtcaccaga gctccaaaaa       300
     ttagctcatc tcgaaatatt agatttcatg tggaataata taagtggttc aattccaaac       360
     gagataggac agatatcatc cctggtactc ttgctgctga atggaaacaa actttcaggg       420
     actttaccaa gcgaactcgg gtatctttcg aacttgaaca ggttccagat agatgagaat       480
     aacatcacag gaccaatacc aaagtccttt tccaacttga aaaaagtgaa acatcttcac       540
     ttcaacaata attcgttgac cggccagatt ccagttgagc tttccaatct tactaacatc       600
     tttcatgtgc tgctagacaa caataaatta tctggaaatc ttccaccaca actctctgca       660
     ttgccaaacc tgcaaatcct gcaacttgat aataacaact tcagtggatc cgatatccca       720
     gcttcctatg gaaacttttc gaatattcta aagctgagtc ttagaaattg tagtttgaaa       780
     ggggcacttc ctgattttag caagatacgt catctcaaat acttggatct tagctggaat       840
     gaactcacag gacctatacc ttcctctaat ttttctaagg atgtgacaac cattaattta       900
     tcaaacaaca tacttaacgg atccatcccg cagagcttct cagatctccc tttacttcag       960
     atgctattgc tgaaaaacaa tatgttatct ggatctgtcc ctgattccct ttggaagaat      1020
     atctcttttc cgaagaaagc tagacttcta cttgatctta ggaataattc tctgtcacgt      1080
     gttcaaggag atctaactcc tccacaaaat gtcactttaa ggcttgatgg caatctgatc      1140
     tgcactaatg gaagcatatc aaacgcaaac ctattctgtg agtccaaagg caaagagtgg      1200
     atatcactac caaacaattc aaccaattct gcactggact gtcctcctct tgcctgtccc      1260
     actcctgact tctacgaata cagtccagca tccccattac gatgcttttg tgcagcgcct      1320
     cttagaattg gatatcgtct caaaagtcct agtttctcat acttccctcc atatattgat      1380
     caatttggcg agtatgttac cgatttcctt caaatggaac catatcaact ctggatcgac      1440
     tcatatcaat gggagaaagg gcctcgtctg aggatgtatc tgaaactttt tccgaaagtt      1500
     aatgaaacct atacaagaac atttaacgag agtgaagttc tcagaatccg aggcatattc      1560
     gcttcatgga gatttcctgg tagtgactta tttggcccgt atgaactgct caacttcact      1620
     ctgcaggggc cttattcata tgttaacttc aacagtgaaa ggaaaggcgt cagctggcga      1680
     cgattggcag caataactgc aggggctgtg gtgactgctg ttgcgatatc cgctgtggtt      1740
     gcagccttgt tgcttagaag atacagcaag cacgagcgag agatatctag aagacggtca      1800
     tcctcgaagg cttccttgtt gaattctggg ataagaggct ttagtttcaa agagctagca      1860
     gaggccaccg acgattttag cagctcaact ttggttgggc gcggaggcta tggaaaggtt      1920
     tacagaggtg tcttatctga caatactgtt gctgcaataa agcgagcaga tgaagggtct      1980
     ttgcaaggtg aaaaggagtt cttgaatgaa atagagctgc tctcgaggtt gcatcatcgg      2040
     aatcttgtgt cactgatcgg ttactgtgat gaagaaagcg agcagatgct ggtgtacgaa      2100
     tttatgtcaa atggcaccct gcgcgactgg ttgtctgcta aggggaagga gtcattgagc      2160
     tttgggatga ggattcgtgt tgcgttggga gcagcaaaag gtattctcta ccttcacaca      2220
     gaagccaacc cgccagtttt ccaccgagac atcaaagcca gtaacatcct cctcgacccc      2280
     aacttcaatg ccaaagttgc agactttgga ctgtctcgac ttgctcctgt tttggaggac      2340
     gaagaggatg tgcctaagca cgtctcaacc gttgtccgtg ggactccagg gtacctggat      2400
     cctgaatatt tcctgacaca caagctgacg gacaagagcg atgtttacag catcggagtt      2460
     gtgttcttgg agctgctgac tggtatgcac gccatatccc atggaaaaaa tatagtacga      2520
     gaggtgaaga cggctgagca gagggatatg atggtatcgc tgatagacaa gagaatggag      2580
     ccgtggtcga tggaaagtgt tgaaaagttt gcggctttgg cactgaggtg tagccacgac      2640
     tcaccagaga tgaggccagg aatggcggag gtggtgaagg agctggagtc actgctccaa      2700
     gcatcccccg atagggagac aagagtggaa ttggcgtcat cttcgtcagt gctgtcaaca      2760
     tcgtcgtcga atgtgacaag agacctttac gagtcgtcga gccttctagg aagcgatctc      2820
     agcagcggct ttgttcccag catcgctcct cgctga                                2856
//

If you have problems or comments...

PBIL Back to PBIL home page