(data stored in ACNUC13479 zone)

EMBL: CP002688.PE187

CP002688.PE187       Location/Qualifiers
FT   CDS_pept        complement(join(365040..365507,365585..365835,
FT                   365919..365985,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369082,
FT                   369285..369532))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01950"
FT                   /db_xref="GOA:A0A1P8BAT4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013210"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAT4"
FT                   /protein_id="ANM68703.1"
FT                   /translation="MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLD
FT                   PKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHL
FT                   EILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNIT
FT                   GPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALP
FT                   NLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNE
FT                   LTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKN
FT                   ISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKE
FT                   WISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPY
FT                   IDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIR
FT                   GIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAI
FT                   SAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRG
FT                   GYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESE
FT                   QLLNLQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFH
FT                   RDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTH
FT                   KLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMES
FT                   VEKFAALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNV
FT                   TRDLYESSSLLGSDLSSGFVPSIAPR"
     atggtgttcc ctcaaagact ctatctacat gcgctccttg ttgcctgttg ttgcgtcctt        60
     ctgcttgccg atgctcaaag aacccaccct tcagaagtca ctgctttacg atctgttaaa       120
     agaagtctac ttgaccctaa agattatttg agaaactgga atagaggcga cccttgcaga       180
     tcaaattgga ctggagttat ctgctttaat gagattggta ctgacgacta cctgcatgtc       240
     cgagaactcc tgctgatgaa tatgaatctc tccgggactt tgtcaccaga gctccaaaaa       300
     ttagctcatc tcgaaatatt agatttcatg tggaataata taagtggttc aattccaaac       360
     gagataggac agatatcatc cctggtactc ttgctgctga atggaaacaa actttcaggg       420
     actttaccaa gcgaactcgg gtatctttcg aacttgaaca ggttccagat agatgagaat       480
     aacatcacag gaccaatacc aaagtccttt tccaacttga aaaaagtgaa acatcttcac       540
     ttcaacaata attcgttgac cggccagatt ccagttgagc tttccaatct tactaacatc       600
     tttcatgtgc tgctagacaa caataaatta tctggaaatc ttccaccaca actctctgca       660
     ttgccaaacc tgcaaatcct gcaacttgat aataacaact tcagtggatc cgatatccca       720
     gcttcctatg gaaacttttc gaatattcta aagctgagtc ttagaaattg tagtttgaaa       780
     ggggcacttc ctgattttag caagatacgt catctcaaat acttggatct tagctggaat       840
     gaactcacag gacctatacc ttcctctaat ttttctaagg atgtgacaac cattaattta       900
     tcaaacaaca tacttaacgg atccatcccg cagagcttct cagatctccc tttacttcag       960
     atgctattgc tgaaaaacaa tatgttatct ggatctgtcc ctgattccct ttggaagaat      1020
     atctcttttc cgaagaaagc tagacttcta cttgatctta ggaataattc tctgtcacgt      1080
     gttcaaggag atctaactcc tccacaaaat gtcactttaa ggcttgatgg caatctgatc      1140
     tgcactaatg gaagcatatc aaacgcaaac ctattctgtg agtccaaagg caaagagtgg      1200
     atatcactac caaacaattc aaccaattct gcactggact gtcctcctct tgcctgtccc      1260
     actcctgact tctacgaata cagtccagca tccccattac gatgcttttg tgcagcgcct      1320
     cttagaattg gatatcgtct caaaagtcct agtttctcat acttccctcc atatattgat      1380
     caatttggcg agtatgttac cgatttcctt caaatggaac catatcaact ctggatcgac      1440
     tcatatcaat gggagaaagg gcctcgtctg aggatgtatc tgaaactttt tccgaaagtt      1500
     aatgaaacct atacaagaac atttaacgag agtgaagttc tcagaatccg aggcatattc      1560
     gcttcatgga gatttcctgg tagtgactta tttggcccgt atgaactgct caacttcact      1620
     ctgcaggggc cttattcata tgttaacttc aacagtgaaa ggaaaggcgt cagctggcga      1680
     cgattggcag caataactgc aggggctgtg gtgactgctg ttgcgatatc cgctgtggtt      1740
     gcagccttgt tgcttagaag atacagcaag cacgagcgag agatatctag aagacggtca      1800
     tcctcgaagg cttccttgtt gaattctggg ataagaggct ttagtttcaa agagctagca      1860
     gaggccaccg acgattttag cagctcaact ttggttgggc gcggaggcta tggaaaggtt      1920
     tacagaggtg tcttatctga caatactgtt gctgcaataa agcgagcaga tgaagggtct      1980
     ttgcaaggtg aaaaggagtt cttgaatgaa atagagctgc tctcgaggtt gcatcatcgg      2040
     aatcttgtgt cactgatcgg ttactgtgat gaagaaagcg agcagttgct gaatttgcag      2100
     atgctggtgt acgaatttat gtcaaatggc accctgcgcg actggttgtc tgctaagggg      2160
     aaggagtcat tgagctttgg gatgaggatt cgtgttgcgt tgggagcagc aaaaggtatt      2220
     ctctaccttc acacagaagc caacccgcca gttttccacc gagacatcaa agccagtaac      2280
     atcctcctcg accccaactt caatgccaaa gttgcagact ttggactgtc tcgacttgct      2340
     cctgttttgg aggacgaaga ggatgtgcct aagcacgtct caaccgttgt ccgtgggact      2400
     ccagggtacc tggatcctga atatttcctg acacacaagc tgacggacaa gagcgatgtt      2460
     tacagcatcg gagttgtgtt cttggagctg ctgactggta tgcacgccat atcccatgga      2520
     aaaaatatag tacgagaggt gaagacggct gagcagaggg atatgatggt atcgctgata      2580
     gacaagagaa tggagccgtg gtcgatggaa agtgttgaaa agtttgcggc tttggcactg      2640
     aggtgtagcc acgactcacc agagatgagg ccaggaatgg cggaggtggt gaaggagctg      2700
     gagtcactgc tccaagcatc ccccgatagg gagacaagag tggaattggc gtcatcttcg      2760
     tcagtgctgt caacatcgtc gtcgaatgtg acaagagacc tttacgagtc gtcgagcctt      2820
     ctaggaagcg atctcagcag cggctttgtt cccagcatcg ctcctcgctg a               2871
//

If you have problems or comments...

PBIL Back to PBIL home page