(data stored in ACNUC13479 zone)

EMBL: CP002688.PE188

CP002688.PE188       Location/Qualifiers
FT   CDS_pept        complement(join(365040..365507,365585..365835,
FT                   365919..365970,366062..366345,366430..366588,
FT                   366682..367202,367278..367346,367434..367520,
FT                   367615..367686,367795..367863,367941..368009,
FT                   368114..368188,368266..368337,368419..368490,
FT                   368583..368726,368833..368904,369011..369075))
FT                   /codon_start=1
FT                   /gene_synonym="T20L15.220"
FT                   /gene_synonym="T20L15_220"
FT                   /locus_tag="AT5G01950"
FT                   /product="Leucine-rich repeat protein kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01950"
FT                   /db_xref="GOA:A0A1P8BAU6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BAU6"
FT                   /protein_id="ANM68706.1"
FT                   /translation="MNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVL
FT                   LLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQ
FT                   IPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSN
FT                   ILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNG
FT                   SIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLT
FT                   PPQNVTLRLDGNLICTNGSISNANLFCESKGKEWISLPNNSTNSALDCPPLACPTPDFY
FT                   EYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPYIDQFGEYVTDFLQMEPYQLWIDSYQW
FT                   EKGPRLRMYLKLFPKVNETYTRTFNESEVLRIRGIFASWRFPGSDLFGPYELLNFTLQG
FT                   PYSYVNFNSERKGVSWRRLAAITAGAVVTAVAISAVVAALLLRRYSKHEREISRRRSSS
FT                   KASLLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSL
FT                   QGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLS
FT                   FGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLE
FT                   DEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNI
FT                   VREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELES
FT                   LLQASPDRETRVELASSSSVLSTSSSNVTRDLYESSSLLGSDLSSGFVPSIAPR"
     atgaatatga atctctccgg gactttgtca ccagagctcc aaaaattagc tcatctcgaa        60
     atattagatt tcatgtggaa taatataagt ggttcaattc caaacgagat aggacagata       120
     tcatccctgg tactcttgct gctgaatgga aacaaacttt cagggacttt accaagcgaa       180
     ctcgggtatc tttcgaactt gaacaggttc cagatagatg agaataacat cacaggacca       240
     ataccaaagt ccttttccaa cttgaaaaaa gtgaaacatc ttcacttcaa caataattcg       300
     ttgaccggcc agattccagt tgagctttcc aatcttacta acatctttca tgtgctgcta       360
     gacaacaata aattatctgg aaatcttcca ccacaactct ctgcattgcc aaacctgcaa       420
     atcctgcaac ttgataataa caacttcagt ggatccgata tcccagcttc ctatggaaac       480
     ttttcgaata ttctaaagct gagtcttaga aattgtagtt tgaaaggggc acttcctgat       540
     tttagcaaga tacgtcatct caaatacttg gatcttagct ggaatgaact cacaggacct       600
     ataccttcct ctaatttttc taaggatgtg acaaccatta atttatcaaa caacatactt       660
     aacggatcca tcccgcagag cttctcagat ctccctttac ttcagatgct attgctgaaa       720
     aacaatatgt tatctggatc tgtccctgat tccctttgga agaatatctc ttttccgaag       780
     aaagctagac ttctacttga tcttaggaat aattctctgt cacgtgttca aggagatcta       840
     actcctccac aaaatgtcac tttaaggctt gatggcaatc tgatctgcac taatggaagc       900
     atatcaaacg caaacctatt ctgtgagtcc aaaggcaaag agtggatatc actaccaaac       960
     aattcaacca attctgcact ggactgtcct cctcttgcct gtcccactcc tgacttctac      1020
     gaatacagtc cagcatcccc attacgatgc ttttgtgcag cgcctcttag aattggatat      1080
     cgtctcaaaa gtcctagttt ctcatacttc cctccatata ttgatcaatt tggcgagtat      1140
     gttaccgatt tccttcaaat ggaaccatat caactctgga tcgactcata tcaatgggag      1200
     aaagggcctc gtctgaggat gtatctgaaa ctttttccga aagttaatga aacctataca      1260
     agaacattta acgagagtga agttctcaga atccgaggca tattcgcttc atggagattt      1320
     cctggtagtg acttatttgg cccgtatgaa ctgctcaact tcactctgca ggggccttat      1380
     tcatatgtta acttcaacag tgaaaggaaa ggcgtcagct ggcgacgatt ggcagcaata      1440
     actgcagggg ctgtggtgac tgctgttgcg atatccgctg tggttgcagc cttgttgctt      1500
     agaagataca gcaagcacga gcgagagata tctagaagac ggtcatcctc gaaggcttcc      1560
     ttgttgaatt ctgggataag aggctttagt ttcaaagagc tagcagaggc caccgacgat      1620
     tttagcagct caactttggt tgggcgcgga ggctatggaa aggtttacag aggtgtctta      1680
     tctgacaata ctgttgctgc aataaagcga gcagatgaag ggtctttgca aggtgaaaag      1740
     gagttcttga atgaaataga gctgctctcg aggttgcatc atcggaatct tgtgtcactg      1800
     atcggttact gtgatgaaga aagcgagcag atgctggtgt acgaatttat gtcaaatggc      1860
     accctgcgcg actggttgtc tgctaagggg aaggagtcat tgagctttgg gatgaggatt      1920
     cgtgttgcgt tgggagcagc aaaaggtatt ctctaccttc acacagaagc caacccgcca      1980
     gttttccacc gagacatcaa agccagtaac atcctcctcg accccaactt caatgccaaa      2040
     gttgcagact ttggactgtc tcgacttgct cctgttttgg aggacgaaga ggatgtgcct      2100
     aagcacgtct caaccgttgt ccgtgggact ccagggtacc tggatcctga atatttcctg      2160
     acacacaagc tgacggacaa gagcgatgtt tacagcatcg gagttgtgtt cttggagctg      2220
     ctgactggta tgcacgccat atcccatgga aaaaatatag tacgagaggt gaagacggct      2280
     gagcagaggg atatgatggt atcgctgata gacaagagaa tggagccgtg gtcgatggaa      2340
     agtgttgaaa agtttgcggc tttggcactg aggtgtagcc acgactcacc agagatgagg      2400
     ccaggaatgg cggaggtggt gaaggagctg gagtcactgc tccaagcatc ccccgatagg      2460
     gagacaagag tggaattggc gtcatcttcg tcagtgctgt caacatcgtc gtcgaatgtg      2520
     acaagagacc tttacgagtc gtcgagcctt ctaggaagcg atctcagcag cggctttgtt      2580
     cccagcatcg ctcctcgctg a                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page