(data stored in ACNUC13479 zone)

EMBL: CP002688.PE19

CP002688.PE19        Location/Qualifiers
FT   CDS_pept        complement(join(27095..27267,27351..27423))
FT                   /codon_start=1
FT                   /locus_tag="AT5G01075"
FT                   /product="Glycosyl hydrolase family 35 protein"
FT                   /note="Glycosyl hydrolase family 35 protein; FUNCTIONS IN:
FT                   hydrolase activity, hydrolyzing O-glycosyl compounds;
FT                   INVOLVED IN: carbohydrate metabolic process; LOCATED IN:
FT                   endomembrane system; EXPRESSED IN: 19 plant structures;
FT                   EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
FT                   DOMAIN/s: Glycoside hydrolase, family 35
FT                   (InterPro:IPR001944); Has 30201 Blast hits to 17322
FT                   proteins in 780 species: Archae - 12; Bacteria - 1396;
FT                   Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0;
FT                   Other Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01075"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01075.1"
FT                   /db_xref="GOA:Q8LEW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LEW6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL111903.1,INSD:EL065227.1,INSD:BP562893.2,
FT                   INSD:DR315685.1,INSD:DR370183.1,INSD:AU227960.1,
FT                   INSD:DR315680.1,INSD:DR315684.1,INSD:DR315682.1,
FT                   INSD:DR315686.1,INSD:DR376369.1,INSD:DR315687.1,
FT                   INSD:DR315681.1,INSD:DR315683.1,INSD:EL122470.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT026404.1,INSD:BT004244.1,INSD:BT020286.1,
FT                   INSD:AY085186.1"
FT                   /protein_id="AED90296.1"
FT                   /translation="MKTSSFVFLLVVIILSFSLLASSSEMKVGLEDYNFPVDPTPTTKA
FT                   SIKPGPIEHGTPLNPYIPKPPSPSSSPPPQQSQDGG"
     atgaagacgt caagctttgt cttccttttg gttgtaataa tcctaagctt ctcactacta        60
     gcttcttctt ctgaaatgaa agtggggttg gaggattaca attttccagt ggatccaact       120
     ccgacgacaa aagcttcgat aaaaccaggt cctattgagc atggaactcc tctcaatcct       180
     tatattccta agcctccttc tccttcttcg tctcctcctc cacagcaatc ccaagacggt       240
     ggataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page