(data stored in ACNUC13479 zone)

EMBL: CP002688.PE191

CP002688.PE191       Location/Qualifiers
FT   CDS_pept        join(370811..371303,371390..371466,371547..371715,
FT                   371872..371960,372074..372238,372316..372393,
FT                   372487..372590,372670..372775)
FT                   /codon_start=1
FT                   /gene_synonym="T7H20.10"
FT                   /gene_synonym="T7H20_10"
FT                   /locus_tag="AT5G01960"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; LOCATED IN: chloroplast; EXPRESSED IN: 23
FT                   plant structures; EXPRESSED DURING: 14 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type,
FT                   conserved site (InterPro:IPR017907), Zinc finger, RING-type
FT                   (InterPro:IPR001841), Zinc finger, C3HC4 RING-type
FT                   (InterPro:IPR018957); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT1G65040.1); Has 30201 Blast hits to 17322 proteins
FT                   in 780 species: Archae - 12; Bacteria - 1396; Metazoa -
FT                   17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other
FT                   Eukaryotes - 2996 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01960"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01960.1"
FT                   /db_xref="GOA:Q8L610"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L610"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL258898.1,INSD:DR265258.1,INSD:DR265259.1,
FT                   INSD:ES132740.1,INSD:BP602982.1,INSD:EL015073.1,
FT                   INSD:DR376177.1,INSD:EH885634.1,INSD:BP617848.1,
FT                   INSD:EL276317.1,INSD:BP798101.1,INSD:ES140842.1,
FT                   INSD:ES054192.1,INSD:BP811157.1,INSD:EH806755.1,
FT                   INSD:BP633168.1,INSD:EH891928.1,INSD:ES181425.1,
FT                   INSD:AA651156.1,INSD:BP778029.1,INSD:EL973782.1,
FT                   INSD:EL991767.1,INSD:BP671641.1,INSD:EL266887.1,
FT                   INSD:DR265260.1,INSD:ES088035.1,INSD:EL260254.1,
FT                   INSD:BP619694.1,INSD:ES022858.1,INSD:EG463064.1,
FT                   INSD:AV562969.1,INSD:DR265264.1,INSD:BP827788.1,
FT                   INSD:DR265261.1,INSD:BP610341.1,INSD:AV440114.1,
FT                   INSD:AV830898.1,INSD:ES012017.1,INSD:EH828778.1,
FT                   INSD:CD530902.1,INSD:DR265262.1,INSD:BP866120.2,
FT                   INSD:EH862623.1,INSD:BP623208.1,INSD:AV809752.1,
FT                   INSD:EL971150.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY087766.1,INSD:BX832142.1,INSD:AY099711.1,
FT                   INSD:BX831206.1,INSD:BX832766.1,INSD:BT000282.1"
FT                   /protein_id="AED90414.1"
FT                   /translation="METPGASHDSFRGSPRRNSILSASNIIQAPISTLLEYSGLFRARP
FT                   SPSHEAETLVSDDSSGLSNGEVAIRIIGNTEQDAETDTNALREPGHSELLGSSATQVDP
FT                   MGGASEGASQAAPGDPAAGDAASRDSPYQRYDIQQAARWIEQILPFSLLLLVVFIRQHL
FT                   QGFFVAIWIAAVMFKSNDILKKQTALKGERHISALIGISVAFTAHVVGVYWWFRKDDLL
FT                   YPLIMLPPKSIPPFWHAIFIIVVNDTLVRQASMIFKCFLLMYYKNSRGRNYRKQGQLLT
FT                   LVEYFMLLYRSLLPTPVWYRFFLNKDYGSLFSSLMTGLYLTFKLTSVVEKVQSFFTALK
FT                   ALSRKEVHYGSYATTEQVNAAGDLCAICQEKMHTPILLRCKHMFCEDCVSEWFERERTC
FT                   PLCRALVKPADLKSFGDGSTSLFFQIF"
     atggaaacgc ccggcgccag tcatgattca tttaggggtt ctcctcgtag aaactccatc        60
     ctctctgctt ctaacatcat ccaggcccct atttctacct tgttagagta ttcgggtctc       120
     tttcgagcta ggccaagtcc tagtcatgag gctgagacgc ttgttagtga tgattcttca       180
     ggactctcca atggggaggt tgccattagg atcattggca acaccgagca ggatgctgaa       240
     actgatacca atgctctgag ggaacccgga cactctgaac tcttgggttc ttctgctact       300
     caggttgatc ccatgggagg tgcttcagaa ggtgcctctc aggctgctcc aggtgatcct       360
     gctgctggag acgccgcttc ccgggattcg ccttaccaaa gatatgatat tcagcaggct       420
     gcacgctgga ttgagcaaat tcttcccttt tctttgcttc tgttggttgt ttttatccgc       480
     cagcatttgc aggggttctt tgtcgccatt tggattgctg ctgtcatgtt caagtcaaat       540
     gatattctca agaagcaaac agctttgaag ggtgagaggc atatctcggc attaattgga       600
     atctctgtag catttacggc ccatgttgtt ggtgtttatt ggtggtttcg gaaggatgac       660
     ctcttgtatc ccttaatcat gctgcctcca aagtccatac cacctttctg gcatgccatt       720
     tttatcatag tggtgaatga tacacttgtc cggcaggcct caatgatttt caagtgtttt       780
     ttgttgatgt actacaaaaa cagtaggggt cggaattatc gtaaacaggg tcaattgcta       840
     actttggttg aatatttcat gcttctgtat cgctctttac tgcctacccc tgtatggtac       900
     cgtttctttt tgaacaagga ttatggaagc ctcttctcct ctcttatgac gggattgtat       960
     cttacattca agctcacttc agtagttgag aaggttcaat ccttctttac ggcattgaag      1020
     gctttgtcac gtaaagaggt gcactacgga tcatatgcaa ctacagagca ggtaaatgca      1080
     gcaggcgacc tgtgtgccat ctgccaggag aagatgcaca ccccaattct tcttcgctgc      1140
     aaacacatgt tttgcgaaga ttgcgtttca gagtggtttg agagagagag gacgtgtcct      1200
     ttgtgcaggg ccttggtcaa accagcagat ctgaaatcat tcggtgatgg atccaccagc      1260
     ctcttcttcc agattttctg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page